KEGG   Exiguobacterium sp. AT1b: EAT1b_0725Help
Entry
EAT1b_0725        CDS       T00897                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EAT1b_0725
  Amino acid metabolism
   00300 Lysine biosynthesis
    EAT1b_0725
Enzymes [BR:eat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     EAT1b_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(677023..678411)
Genome map
AA seq 462 aa AA seqDB search
MNWRQEVDNRKDAFLEDLKGLLQIPSVLDESKAAPNMPFGPEVRQALDYMFEIGERDGFK
TKDVGGYAGHLEYGDGEEIVGILCHLDVVPAGDGWTYGAFNPTITTDGKIVARGSNDDKG
PSMAAYYGLRIVKELGLPLSKRVRLIAGCDEESEWRCVREYFKQEQMPTYGFAPDADFPI
INAEKGLYDGVLTQLPIQRVPGSAYHLVSFTSGERPNMVPDFAKAELKTDEVLEEKFEAY
LEKYEADGTCEYDRGTYTFTMKGKAAHAMEPDNGINAAYVLAGFLLHLPLDIQGERFIEL
VRHVFADSRGISLGIEASDETGDLTINGGVFRYNEEERTATVNIRYPYTAKFEERLQNLR
EIALSFGFELKTRQHMPPHHVAEDHPLVKTLADVYERQTGEHANLMAIGGGTYARSLEAG
VAFGALFPGAKDVAHQVDEYMEIEDLLRAAAIYAEAIYELAK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaattggagacaggaagtcgacaatcgtaaagatgcatttttagaagatttgaaagga
ttacttcaaatccctagcgtgctcgatgaatcgaaagcggcaccgaacatgccgtttggt
cctgaggttcgtcaggcgcttgactacatgtttgaaattggtgagcgagatggattcaaa
acaaaggacgtcggcggttacgcgggacatttggaatacggggacggtgaggaaatcgtc
ggcattctatgtcaccttgacgtcgtcccagcaggcgatggctggacatatggcgcattc
aatccgaccatcacaactgacgggaaaattgtagcgcgtggaagtaacgatgataaaggt
ccgtctatggcggcatactatggattacgaatcgtcaaagagctcggcttaccactttca
aaacgcgtccgtttgattgcaggttgcgatgaggagagcgaatggcgctgtgtccgtgag
tatttcaaacaagaacagatgccgacatacggatttgcgccagatgcggatttcccgatc
atcaatgctgaaaaaggattgtatgacggtgtgttgactcaattaccgattcaacgtgta
ccaggttctgcctaccatctcgtgtcattcacgagtggggagcgtccgaatatggtgccg
gacttcgcgaaagccgaattgaagacggatgaggtactcgaggagaagttcgaggcgtat
cttgaaaaatatgaagctgacggaacgtgtgaatacgaccgtggcacatatacgtttacg
atgaaaggaaaagcggcgcacgcgatggaaccggataacgggatcaatgctgcgtacgtg
ctggctgggttcctgttgcaccttcctctcgacattcaaggggaacgcttcattgaactc
gttcgtcacgtgtttgcagactcacgtggaatttctctcgggattgaagcgagcgatgag
acgggcgacttgacgatcaatggcggcgtgttccgatacaatgaggaagaacgaacagca
acggtcaacatccgttacccgtatacggccaaattcgaagaacgtttacaaaacctacgt
gaaatcgcgttgtcatttggtttcgagttgaagacccgtcaacatatgccgcctcatcac
gtggcagaagatcacccactcgtgaagacgctagcagacgtatacgagcgtcaaacggga
gagcacgcgaacttgatggccatcggaggcggtacgtatgcacgttcactcgaggctggt
gtcgcgttcggcgcattgttcccaggcgctaaagatgtggcgcatcaggtcgatgaatat
atggagatagaagatttattacgcgctgcagcaatctatgctgaggccatttacgagctc
gctaaataa

DBGET integrated database retrieval system