KEGG   Exiguobacterium sp. AT1b: EAT1b_0853Help
Entry
EAT1b_0853        CDS       T00897                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
eat  Exiguobacterium sp. AT1b
Brite
Enzymes [BR:eat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     EAT1b_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(806200..806940)
Genome map
AA seq 246 aa AA seqDB search
MKVTAPKPFFFEGGQRAVLMLHGFTGSSADVRMLGRFLQKEGYTCMGPIYRGHAVPPEEL
LQYGPKDWWEDVLDAYQTLVDKGHEEIVVCGLSLGGVMSLRLAEEKDVKAVIPMCAPTGI
DAEDRLYKGVQAYAREYKGREEKSPEQIEQEMAEFKPMPTLKDLRAFVRDTASKLEDIFV
PTLVVQGAKDNMIDPESANQIYEAVNTFQKELLIYENSGHVITLDKEKEKLHQDVLDFLE
TLDWSV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgacagcaccaaaaccgttcttcttcgagggcggacaacgtgccgtgttgatg
ttacatggcttcactggatcgagcgcggatgtccgcatgctcggtcgcttccttcaaaaa
gaaggatacacatgtatgggaccgatctatcgtggtcatgccgtcccaccggaagaatta
ctccaatatggaccgaaagactggtgggaagacgtcttggacgcctaccagacactcgtc
gacaaaggccatgaggaaatcgtcgtctgcggactctcgctaggtggcgtgatgtcgctc
cgtctcgccgaggagaaagacgtcaaggcggtcatcccgatgtgcgcaccgacgggaatc
gatgccgaggaccgcttgtataaaggagtccaagcatatgcccgagaatataagggtaga
gaagaaaagtcgccggaacagatcgagcaggaaatggcagagttcaaaccgatgccaaca
ttgaaagacctccgtgccttcgtccgcgacacggcgtcgaagctcgaggacatcttcgtc
ccgacactcgtcgtccaaggcgccaaagacaacatgatcgacccggaatcggcgaatcaa
atttacgaggcggtcaacacgttccaaaaagagttgctcatctatgagaactcgggacac
gtgatcacactcgacaaagaaaaagagaaactgcaccaggacgtgctcgattttctcgaa
acgttagactggtcagtctaa

DBGET integrated database retrieval system