KEGG   Exiguobacterium sp. AT1b: EAT1b_0862Help
Entry
EAT1b_0862        CDS       T00897                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_0862 (tpiA)
   01230 Biosynthesis of amino acids
    EAT1b_0862 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_0862 (tpiA)
   00051 Fructose and mannose metabolism
    EAT1b_0862 (tpiA)
   00562 Inositol phosphate metabolism
    EAT1b_0862 (tpiA)
Enzymes [BR:eat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EAT1b_0862 (tpiA)
Exosome [BR:eat04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EAT1b_0862 (tpiA)
  Exosomal proteins of bladder cancer cells
   EAT1b_0862 (tpiA)
  Exosomal proteins of melanoma cells
   EAT1b_0862 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(815857..816609)
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVAFVEEVKNNIPSTDKVDAAIGAPALFLAPMVEAAKGSNLK
LGAQNMYDKDSGAYTGEISPAMIADLGVTYVILGHSERREYFGESDAFINSKTKKAFEHG
LTPIVCVGETLEEREGDKFEEVIKTQVEGGLADLSADQVKQLVIAYEPVWAIGTGKSADE
ADAQSSCKYVRDVVKGLYGEDVAAAVRIQYGGSVKPENIKEYMAQEDIDGALVGGASLEA
ASFLKLLEAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccgattattgcaggtaactggaaaatgaacaaaacactctcggaagctgtt
gctttcgttgaggaagtaaaaaacaacatcccatctactgacaaagtagatgcagcgatt
ggtgctccagcacttttcctcgcaccgatggtagaagcagctaaagggtcaaacttgaag
ctcggtgcacaaaacatgtacgacaaagatagcggtgcctacactggcgaaatcagccca
gctatgatcgctgacctcggcgtgacttacgtcatcctcggtcactcagaacgtcgcgag
tacttcggcgaatcagatgcgttcatcaacagcaaaacgaaaaaagcgttcgaacacggt
cttacgccaatcgtttgtgtcggtgaaacactcgaggagcgcgaaggcgacaagttcgaa
gaagtcatcaaaacacaagtcgaaggcggcctcgctgacctttctgctgaccaagtcaaa
caactcgtcatcgcgtatgagccagtttgggcaatcggtacagggaaatcagcggacgaa
gcagacgcgcaaagctcttgtaaatatgttcgcgacgtggtgaaaggtctttacggtgaa
gacgtagcggctgcagtacgcatccagtacggtggatctgtaaaaccagagaacatcaaa
gagtatatggcacaggaagacatcgacggcgcactcgtcggcggtgcttcacttgaagcc
gcttcgttcctcaaattgttggaggcgatttaa

DBGET integrated database retrieval system