KEGG   Exiguobacterium sp. AT1b: EAT1b_0887Help
Entry
EAT1b_0887        CDS       T00897                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EAT1b_0887
Enzymes [BR:eat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EAT1b_0887
Exosome [BR:eat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAT1b_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
841168..842685
Genome map
AA seq 505 aa AA seqDB search
MAKEKRYILALDQGTTSSRAIIFDHDGKIVTVAQREFKQYFPKPGWVEHNANEIWGSVLA
VMAEAFGSADIDPNEIAGIGITNQRETAVVWEKETGRPVYNAVVWQSRQTADICEELKAA
GHSDMVRDKTGLLIDAYFSGTKVKWILDNVEGAREKAENGELLFGTIDTWLIWKLSGGKA
HVTDYSNASRTLMYNIYEQKWDDELLDILTVPKSMLPEVKPSSEVYANTIPYHFFGFEVP
IAGAAGDQQAALFGQTCFEKGEAKNTYGTGCFMLMNTGEEAVKSDHGLLTTIAWGYNGKV
EYALEGSIFVAGSAIQWLRDGLRMLKSAKDSEQYATRIESTDGVYVVPAFVGLGAPYWNS
DVRGAIFGLTRGTEKEQMVRATIESLAYQTRDVLTSMESDSGINLKTLRVDGGAVSNNFL
MQFQSDILNVPVERPEVSETTALGAAYLAGLAVGFWKDQAEVKDQWKLDKKFDPNMDESH
REALYKGWQHAVEATMAFKPSKLEV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaaaaacgttatattttagcattggaccaaggaacgacaagttcacgggca
atcatttttgatcatgatggaaaaattgtcaccgtcgcacagcgcgaattcaaacaatac
ttcccaaaaccaggctgggtcgagcacaacgccaatgagatttggggctctgtcctcgcc
gttatggcggaagcgttcggttctgctgatatcgacccgaatgagattgctggaatcggg
atcacaaaccaacgtgaaacagctgtcgtctgggaaaaagaaacaggacgccctgtctat
aacgccgttgtctggcaatcccgtcaaaccgccgacatctgtgaagagctgaaagcagcc
ggtcattccgatatggtccgcgacaaaacaggtctcctcatcgatgcctacttctcagga
acaaaagtcaaatggattcttgacaacgtcgagggtgcacgtgaaaaagctgagaacggc
gagctcctcttcgggacaatcgacacgtggctcatttggaaactctctggtggaaaagca
cacgtaaccgattactcgaacgcatcgcgtacactcatgtacaatatctacgagcagaag
tgggatgacgagttactcgacatcttgacagtgcctaaatccatgcttcctgaagtcaaa
ccgtcaagtgaagtctatgcgaacacgattccataccacttcttcggattcgaagtcccg
attgccggagcagcaggtgaccaacaggccgccttgttcggacaaacgtgcttcgaaaaa
ggtgaggcgaaaaacacgtacggaacaggttgtttcatgctcatgaacacgggagaagaa
gccgtcaaatccgatcacggtctcttgacgacaatcgcatggggctataacgggaaagta
gaatatgcgctcgaaggatcaatcttcgtcgccggttctgcgatccagtggctccgtgac
ggattgcggatgttgaaatcagcgaaagactcggaacagtatgcgacacggatcgaatca
actgacggtgtctatgtcgttcctgccttcgttggtctcggtgccccgtactggaactct
gacgtccgtggtgccatcttcggtctcacgcgtgggacagagaaagaacagatggtccgt
gcgacaatcgagtcactcgcttaccagacacgtgatgtcctcacgtcgatggagagtgat
tcaggcatcaacttgaagacgctccgcgtcgatggtggggccgtcagcaacaacttcctc
atgcagttccaatcggacattctcaatgttccggtcgaacgtcctgaagtgagtgaaacg
actgcactcggtgccgcctacttggcgggtctcgccgttggattctggaaagaccaagcc
gaagtcaaagaccagtggaaactcgacaagaagttcgatccgaacatggacgagtctcac
cgtgaagccctctacaaaggatggcaacacgcagtcgaagccacaatggcattcaaacct
tcaaaacttgaagtataa

DBGET integrated database retrieval system