KEGG   Exiguobacterium sp. AT1b: EAT1b_1203Help
Entry
EAT1b_1203        CDS       T00897                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EAT1b_1203
Enzymes [BR:eat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     EAT1b_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1177123..1178328)
Genome map
AA seq 401 aa AA seqDB search
MKWETIEEVLHELGETSQEKWEQLFEKWSDHRWHDHERPSEKTNVLLMDAGFILTDGRAN
LEALHQWLADHVQTTVSDLYLVSLFPYQPKQQDTAIDSRVQLFEDLGRFTDTFDLIYEMT
PEAWNEAQFDLVTVTDELIERLAYGATKIRVHVESFRGMEPERVKHILKLWRTVMHTYKP
NAQLIIANERVDSALIYEAEADVVCHFDLSSHVILAFAQADVTRLSDWASQVHPLRADQT
YFNFLSSAERDPFEKNLMDTNPDVILAAHSVLLSLQGIPLIDYRTLFGVSQPVEQEDLVR
ALKRDPDRLRVYEGILSQLNVKRLQPALSPYTDQEIVRLDRRVFAVKRKHQGETLLLLTN
MSEETVQTDCEGTSLFTEEWMSHVTLRPYEYVWIKQKHTGE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgggaaacgattgaagaggtgcttcacgaactcggggagacctcacaagaaaag
tgggagcagttatttgaaaagtggtcggatcatcgttggcacgaccatgagcgtccgtct
gaaaaaacaaacgtcttgttgatggatgccgggtttattctgacggacggtcgagcgaac
ctcgaggctctccatcaatggttagccgatcacgtccaaacgacggtgagtgatctttat
ctcgtctctcttttcccatatcaaccgaaacaacaggacacggcgatcgactcgcgggtg
caactattcgaagacttaggacgtttcaccgacacgttcgatttgatttacgagatgacg
cctgaagcatggaatgaggcgcaattcgaccttgtcaccgtaacggatgaactgatcgaa
cgtctagcgtacggagcgacgaaaatccgcgtccatgtcgagtcgtttcgtggaatggag
ccggaacgagtcaaacacatcctcaagctatggcggacggtcatgcatacgtataagccg
aatgcgcagctgattatcgccaatgagcgtgtggattctgccctcatctatgaggcggaa
gcggacgtcgtctgccatttcgacttatccagccatgtgattttagcgtttgcgcaggcg
gatgtgacacgtttgagtgattgggcgagtcaggtgcatccgctgagagccgatcaaacc
tatttcaatttcctctcttcggcggaacgtgatccgtttgagaaaaatctgatggacact
aacccagatgtgattctcgcagcccacagtgtattgttgtcgcttcaagggattccgttg
attgattaccgaactttatttggggtgtcgcaaccggttgaacaggaagatctcgtccga
gcattgaaacgcgatccagatcgacttcgtgtttatgaagggatattgagccaattgaat
gtgaaacgactccaacctgccttgtcaccgtataccgaccaagagatcgtacgtctcgac
cgccgcgtattcgccgtcaagcggaagcaccaaggagagaccctcctgttattgacgaac
atgagtgaggagacggtgcagacggattgcgaaggaacgagtctctttacagaagaatgg
atgagccatgtgacgcttcgcccatatgaatacgtttggataaaacaaaaacacactgga
gagtga

DBGET integrated database retrieval system