KEGG   Exiguobacterium sp. AT1b: EAT1b_1449Help
Entry
EAT1b_1449        CDS       T00897                                 

Definition
TspO and MBR-like proteins (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eat01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:eat00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:eat00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1415181..1415948)
Genome map
AA seq 255 aa AA seqDB search
MKLETAIRQREGAAFVPYIMAGDGGMDRLIPTIVELERMGATAIELGIPFSDPVADGPII
EAAGMRALEAGVTLEMVLNHLIEGNDQFNVPIVLMTYLNPVFRFGVQPFFDRANECGVSG
VIIPDLPFEESLQLFADVNRHDVAVIPLVTLTSSEARTTSILEKAEGFVYAVTLKGTTGK
ADVFPDELLAYLTRLTEQSRVPVLAGFGVHRPEQVQTLGQACDGVVVGSFIVEALHEGRT
EDVETLIQSAKHLHA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagagacagcgattcgacagcgagaaggagcggcgttcgttccgtatatcatg
gccggtgacggcgggatggaccggctcatcccgaccatcgtggaactagagcggatgggt
gcgacggcgattgaactcggtatccctttctccgatccggtggcagatggcccaatcatt
gaggcggcaggaatgcgcgcgcttgaagcaggtgtgacgcttgaaatggtattgaaccat
ttaatagaaggaaatgatcaatttaacgttccaatcgtcttgatgacctacttgaatcca
gtgtttcggttcggggtccaaccgttctttgatcgggcgaacgaatgtggggtgagcggg
gtcattattcctgaccttccgtttgaggagagtctccagttattcgcagatgttaatcgg
catgacgtcgccgtcattccgctcgtcacgttgacgagcagtgaggcgcggacaacgtcc
atcttagaaaaagcagaaggattcgtgtatgcggtcacgcttaaagggacgaccgggaaa
gcagatgtgttcccggacgagttactcgcctacttgactcgtttgacagagcagtcacgt
gttcccgtcttggcaggattcggagtccatcgtccggagcaagtgcagacgttaggacag
gcgtgtgacggtgtcgtcgtcgggagtttcattgtcgaggcacttcatgaaggacggaca
gaagatgttgagacgttgattcaatcagcaaaacacttacacgcataa

DBGET integrated database retrieval system