KEGG   Exiguobacterium sp. AT1b: EAT1b_1449Help
Entry
EAT1b_1449        CDS       T00897                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EAT1b_1449
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAT1b_1449
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAT1b_1449
Enzymes [BR:eat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EAT1b_1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1415181..1415948)
Genome map
AA seq 255 aa AA seqDB search
MKLETAIRQREGAAFVPYIMAGDGGMDRLIPTIVELERMGATAIELGIPFSDPVADGPII
EAAGMRALEAGVTLEMVLNHLIEGNDQFNVPIVLMTYLNPVFRFGVQPFFDRANECGVSG
VIIPDLPFEESLQLFADVNRHDVAVIPLVTLTSSEARTTSILEKAEGFVYAVTLKGTTGK
ADVFPDELLAYLTRLTEQSRVPVLAGFGVHRPEQVQTLGQACDGVVVGSFIVEALHEGRT
EDVETLIQSAKHLHA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagagacagcgattcgacagcgagaaggagcggcgttcgttccgtatatcatg
gccggtgacggcgggatggaccggctcatcccgaccatcgtggaactagagcggatgggt
gcgacggcgattgaactcggtatccctttctccgatccggtggcagatggcccaatcatt
gaggcggcaggaatgcgcgcgcttgaagcaggtgtgacgcttgaaatggtattgaaccat
ttaatagaaggaaatgatcaatttaacgttccaatcgtcttgatgacctacttgaatcca
gtgtttcggttcggggtccaaccgttctttgatcgggcgaacgaatgtggggtgagcggg
gtcattattcctgaccttccgtttgaggagagtctccagttattcgcagatgttaatcgg
catgacgtcgccgtcattccgctcgtcacgttgacgagcagtgaggcgcggacaacgtcc
atcttagaaaaagcagaaggattcgtgtatgcggtcacgcttaaagggacgaccgggaaa
gcagatgtgttcccggacgagttactcgcctacttgactcgtttgacagagcagtcacgt
gttcccgtcttggcaggattcggagtccatcgtccggagcaagtgcagacgttaggacag
gcgtgtgacggtgtcgtcgtcgggagtttcattgtcgaggcacttcatgaaggacggaca
gaagatgttgagacgttgattcaatcagcaaaacacttacacgcataa

DBGET integrated database retrieval system