KEGG   Exiguobacterium sp. AT1b: EAT1b_1452Help
Entry
EAT1b_1452        CDS       T00897                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eat01100  Metabolic pathways
eat01110  Biosynthesis of secondary metabolites
eat01130  Biosynthesis of antibiotics
eat01230  Biosynthesis of amino acids
Module
eat_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAT1b_1452
Enzymes [BR:eat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     EAT1b_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth ThiG PEP_mutase ComA NanE DHO_dh NMO
Motif
Other DBs
NCBI-ProteinID: ACQ70379
JGI: EAT1b_1452
UniProt: C4KZ66
Position
complement(1417659..1418420)
Genome map
AA seq 253 aa AA seqDB search
MSYLTKIIGTKIEEVSGMQPIDVPVTKPISLLHVMSEGFHIISEIKRSSPSKGMIRETVD
VAKRARQYEKAGATMISVLTDTTYFNGSFDDLRQVADVVTIPVLCKDFIIDERQLDYAKH
YGASVALLIVAALHPTRLHELTRYARSIGLDVLVEVHDEAELRIALELDDVLIGINNRDL
KTFEVSLETSIDLMKRYPEVTFVSESGVSTVEAAARLQEAGASAILVGEALMREEDPIRL
LEELKTCSLKSVD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttaacgaaaatcatcggaacgaaaatagaagaggttagcggcatgcagccc
atcgatgtccccgtgacgaagccaatctctctcttacatgtgatgagcgagggattccat
atcatttcagagatcaaacggtcgtccccctcgaaaggaatgattcgggaaacggtcgac
gtcgctaaacgggcacgtcaatatgaaaaagctggtgcgacgatgatctccgttttgaca
gacacgacgtacttcaatggatcgtttgacgacttgcgacaagtcgccgatgtcgtcacc
atcccggtgctttgtaaagatttcatcatcgatgaacgacaactcgactatgcgaagcat
tacggcgcgagtgtggcacttttgatcgtggcggcactacatccgacacgtctccatgag
ttgacgcgatacgctcgctccatcggtctcgacgtcttagtggaagtacatgacgaggcg
gagttacgcatcgcgctcgaacttgatgacgtgttgatcggcatcaataacagagactta
aaaacgttcgaggtatccctcgagacatcaatcgatttgatgaaacgctatcctgaggtc
acattcgtcagcgaaagtggtgtcagtacagtcgaggcggctgcacgtttacaagaagct
ggggcaagcgccattctcgttggggaagcactcatgcgtgaagaggacccgatccggtta
ctcgaggagttgaaaacatgttcgttaaaatctgtggactaa

DBGET integrated database retrieval system