KEGG   Exiguobacterium sp. AT1b: EAT1b_1596Help
Entry
EAT1b_1596        CDS       T00897                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00220  Arginine biosynthesis
eat00330  Arginine and proline metabolism
eat01100  Metabolic pathways
eat01110  Biosynthesis of secondary metabolites
eat01130  Biosynthesis of antibiotics
eat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    EAT1b_1596
   00330 Arginine and proline metabolism
    EAT1b_1596
Enzymes [BR:eat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     EAT1b_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACQ70522
JGI: EAT1b_1596
UniProt: C4KZK9
Position
complement(1547915..1548817)
Genome map
AA seq 300 aa AA seqDB search
MQWSYIHVPLRYGQGKLGVDQGPTKLNEMGMQQLLPTETVKHTIRVLPESEIRENEEHLK
RVDGVLHTVTELAEVVHREISEKRFPLIVGGDHSMAIGTLAGLAQTGPYGVVWVDAHADL
NTGETSPSGNIHGMPLAAAMGMGDVRLTEVGGRDPKLSPEHLVYIALRDIDEGEMNEINR
LGIKVITVEEVRTRGVDVIMQEAMRYLRERVDRFYISFDMDSLDASLVPGTGTPVDGGLT
EVEAKAILKEAMQAEDLIAVELVELNPALDRDDVTAQLAYRLCETIIKSKENLLLEGETV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaatggtcatatattcacgtgccgctgcgttacggtcaggggaaattaggggtcgat
caaggaccgacaaagttaaatgaaatggggatgcaacaactccttccaacagaaacggtc
aaacatacgattcgtgtcttgccggaatctgaaattcgagaaaatgaagaacatttaaaa
cgggtcgatggtgtcctgcataccgtcacggaattagcagaagtcgtacatcgtgagatt
tcagaaaaacgattcccattgatcgttgggggcgatcatagtatggcaatcggtactctt
gctggattggctcaaacaggcccttatggagtcgtttgggtggatgctcacgctgacttg
aatacaggcgaaacgtcaccatcggggaacattcacggaatgccacttgcggcagcgatg
gggatgggcgacgtgcgtctgacagaagtgggcggacgtgatccgaagctatcaccagag
cacttagtttatattgccctgcgtgatatcgatgaaggagaaatgaatgaaatcaatcga
ctcggcatcaaagtcattacagtagaagaagtacgtacgcgtggtgtggatgtcatcatg
caagaggcaatgcgttatcttcgtgaacgagtagaccgtttttatatcagtttcgatatg
gatagtctcgatgcatccctcgttcctggaacaggtacaccggttgacggcggtttaaca
gaagtcgaagccaaagcgattttaaaagaagcgatgcaagcagaagacttgattgcagta
gagctcgtcgagttaaatccggcattagaccgagatgacgtgacggctcagttggcctat
cgcctatgtgaaacgattattaaatctaaagaaaacctgttattggaaggcgaaaccgtc
tga

DBGET integrated database retrieval system