KEGG   Exiguobacterium sp. AT1b: EAT1b_1656Help
Entry
EAT1b_1656        CDS       T00897                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:eat00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1598269..1599723)
Genome map
AA seq 484 aa AA seqDB search
MSEVRVRYAPSPTGHLHIGNARTALFNYLFARHAGGKMILRIEDTDQKRNVLNGVESQMK
YLEWLGIDWDEGPGRDGDYGPYYQMERLAIYEKYVNELMSKGLAYKCYMTSEELEAEREA
QIARGEAPRYSGAHRNLTVEEREAFEAEGRKPSIRIRVPEGVTYKWTDVVKGDVSFESKD
FGDWVIVKQDGIPTYNFAVVVDDHLMKISHVLRGDDHIANTPKQMMVYDALGWDYPEFGH
MTLIYNDQHKKLSKRDESIIQFIEQYADLGYLPAALFNFISLLGWSPVGEEEIFSKEEFI
EMFDAKRLSKSPAVFDQQKLSWINSVYMKKATLDEVVALSLPFLQEAGRLPEAVSVEEAD
WATNLIALYKEQMTHGAEIVALTDLFFKDEIEYDEEANAVLSGETVPAVLAEFKQQLEAI
EDFTPEAIKAATKATQKATGQKGKNLFMPIRVATTGQTHGPELPNAISLIGKERVLKRLT
TLLA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtgcgtgtacgctatgcgcctagtccgacggggcatctccatatcggaaat
gcgcggactgcgttgtttaactacttatttgctcgccatgctggcggaaaaatgattctt
cggattgaagacactgaccagaaacggaatgtgttgaacggtgtcgagagtcagatgaaa
tacttggaatggctcggcatcgactgggatgaaggtccaggtcgtgacggagactacggc
ccatattatcaaatggagcgtcttgcgatttatgaaaaatacgtcaacgagttgatgagc
aaaggcctcgcttataaatgctacatgacttctgaggagcttgaagcagagcgtgaagca
caaatcgcacgtggggaggcaccacgttattcgggtgcgcaccgtaacctcactgttgaa
gagcgtgaagcgtttgaagcggaagggcgtaaaccgtctattcggatccgtgtgccggaa
ggcgtgacgtataaatggacagatgtcgtcaaaggagacgtctcgtttgaatcaaaagat
ttcggtgactgggtcatcgtgaaacaggatggcattccgacgtacaacttcgcagttgtc
gtggacgaccatttgatgaagatcagtcacgtgttgcgtggggacgatcacatcgcgaac
acaccgaaacagatgatggtctatgatgcactcggttgggactatcctgaattcggtcac
atgacgctcatctacaatgaccaacataagaagttatcaaaacgggacgaatcgattatt
cagttcatcgaacaatatgcggatctcggctacttgccagcagcactctttaacttcatt
tcgctccttggctggtcaccggtcggggaagaagaaatcttctcaaaagaagagttcatt
gaaatgtttgatgcgaaacgtttgtcgaagagtccggcagtttttgaccaacaaaaactt
tcttggatcaacagtgtatacatgaagaaggccacgcttgacgaagtggtggcactcagt
ttaccattcttacaagaagcaggacgattacccgaggcggtatctgttgaggaagcggat
tgggcgacaaacttgattgcattgtataaagaacaaatgacgcacggagcagaaatcgtc
gcgttgacagacttgttcttcaaagatgaaatcgagtatgacgaggaagcgaacgctgtc
ctttcaggtgaaacggtacctgctgttcttgcagagttcaaacagcagctcgaagcaatc
gaagacttcacaccggaagcgattaaagcggcgacgaaagcgacgcaaaaagcgaccggt
caaaaagggaagaacttgttcatgccgatccgtgtcgctacgacagggcaaacacatgga
ccggaactcccgaacgccatttcgttaatcggaaaagagcgtgtgttgaagcgtctgaca
actttattagcgtaa

DBGET integrated database retrieval system