KEGG   Exiguobacterium sp. AT1b: EAT1b_1667Help
Entry
EAT1b_1667        CDS       T00897                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EAT1b_1667
Enzymes [BR:eat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     EAT1b_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1615957..1616454)
Genome map
AA seq 165 aa AA seqDB search
MIYIALGANIGDRAGQLSAAIDEMERTGLRVTKQSSVYETAPVGYTEQPSFFNMVVEVES
RQSSDELLKTLQQIEQRLGRERLFKNGPRTIDLDILFYNGEDIQSEHLTVPHPRMQERAF
VLAPLAEIAPELVVRGRTVASWLEGLPMTDRQDVVRLQLLTNLVK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatttatattgcattaggagcaaacattggagatcgggctgggcagttgtctgcggca
atcgatgagatggagcgaacgggtctccgtgtcacgaaacagtcgtcggtctatgagacg
gctcctgtcggatatacagagcaaccttcgttttttaatatggtggtcgaagtcgagagt
cgccaatcctcggacgaactgctcaaaacgcttcaacagatcgaacaacgattaggacgg
gaacgtctatttaagaacggaccgcgtaccatcgaccttgacatcctcttttataacggg
gaagatatacaatcagaacacttaacggttccgcatccgcgcatgcaggaacgtgcattt
gttcttgccccgttagcagagatcgcaccagaactcgtcgttcgaggacggacggtcgcc
tcttggcttgaagggttaccaatgacggaccgccaagatgtcgtccggttacagttgctt
acgaatttggtgaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system