KEGG   Exiguobacterium sp. AT1b: EAT1b_1669Help
Entry
EAT1b_1669        CDS       T00897                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EAT1b_1669
Enzymes [BR:eat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     EAT1b_1669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1616809..1617594)
Genome map
AA seq 261 aa AA seqDB search
MTKIMGILNVTPDSFSDGGRYTAIEEAVRHAKQLVQEGADAIDIGGESTRPGAVLVSEEE
EIERVVPIIRRLKNEIDVPISIDTYKPMVARAAIEAGATIINDVWGSKWGDRSMARVAFE
CEVPIILMHNRTDRDYHHFIEDVVSDLQESIEIAHAAGVRDEHIWLDPGIGFAKDVAQNL
ELMNHLDVITRLGYPVLLGTSRKSFIGHTLDLPTEERLEGTIATTCLGIMKGCDWVRVHD
VKANARAAKMMDAMIGGNGHG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatcatgggtattttaaacgtgaccccggactcgttttcggatgggggacgg
tatacggcaatcgaggaagctgtacgacatgcgaaacaactcgtacaagaaggtgccgat
gcgattgatatcggtggagaatcgacaaggccgggcgcagtacttgtttccgaggaagaa
gagattgaacgtgtcgtcccaatcatccgtcgactgaaaaacgaaatcgatgttccgatt
tcgattgatacgtataagccgatggtggcgagagcggcaatcgaggccggtgcgacgatc
atcaatgacgtatggggttcgaaatggggagaccgctcgatggcacgtgtcgctttcgaa
tgtgaggttcccatcattctcatgcacaaccgaacagaccgggactaccatcatttcatt
gaagatgtggttagcgatctacaggaatcaattgagattgcacatgcggcaggcgtaagg
gatgagcacatttggttagatccgggcatcggatttgcgaaagacgtggcgcaaaacctt
gaactcatgaatcatctcgacgtgatcacacgtcttgggtatcctgttctgctcggcacg
tcgcgtaagtcgtttatcgggcatacactcgatttaccgacagaggaacggctcgaagga
acgattgcgacgacgtgtcttggcatcatgaaaggatgcgactgggtgcgtgtgcacgac
gtcaaagcgaacgcccgtgctgcgaagatgatggatgcgatgattggggggaacggacat
ggataa

DBGET integrated database retrieval system