KEGG   Exiguobacterium sp. AT1b: EAT1b_1691Help
Entry
EAT1b_1691        CDS       T00897                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00900  Terpenoid backbone biosynthesis
eat01100  Metabolic pathways
eat01110  Biosynthesis of secondary metabolites
eat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EAT1b_1691
Enzymes [BR:eat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     EAT1b_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACQ70617
JGI: EAT1b_1691
UniProt: C4KZV4
Position
complement(1642717..1643598)
Genome map
AA seq 293 aa AA seqDB search
MGRVNVMRTISVKAPAKINLTLDVLGKRPDGYHEVEMVMTTVDLADRLELTILESDEIRI
QSEHAYVPNDHRNLAYRAAELLRERFNIQQGVEIVLDKQIPVAAGLAGGSSDAAATLRGM
NELFSLNLSLEELAELGAEIGSDVSFCVIGGTAIARGRGEQLEMIPSPPPCYVVLGKPKI
GVSTADVYRAVRMEEVHHPDTDAMVEAIRQKDFHGICEHLGNSLESVTLKLHPEVKQIKE
TMRHCGAEGVLMSGSGPTVFALIEHEQKAHRIYNGLKGFCPEVFVVRILGKRH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggaagggtgaacgtgatgcgcacgatcagtgtgaaagcgccggcaaaaattaatttg
acacttgatgtcctcggaaagcgtccggacggctatcatgaagtagaaatggtaatgacg
acagtcgacttagcagatcgcttggagttgacgattttagaatcggatgagattcggatt
caatcagaacacgcctatgtgccgaatgatcatcggaatttggcgtatcgagcagcagaa
ttgttgcgcgagcgttttaacattcagcaaggggtcgagattgtgctcgataaacagatt
cccgtggcagctggccttgcaggtggctcgagtgatgcggcggcaacgctccgcgggatg
aacgaactgttttcattgaacttgtcattagaggagctagcagagctcggtgccgagatt
ggatcggacgtgtcgttttgtgtcatcggtggcacagccattgcaagaggtcgtggtgaa
cagttagaaatgattccgtccccgccaccgtgctatgtcgttctcggtaaaccgaaaatt
ggggtatcgacggcagatgtgtatcgggcagtgcgtatggaagaggtacatcatcctgat
accgatgccatggtggaggcgattcgccaaaaagattttcatggaatctgtgaacacctt
gggaactcacttgagagtgtgacactcaagctgcacccggaagtgaaacagatcaaagaa
acgatgcgtcattgcggagcggaaggtgttctcatgagtggaagcggaccgaccgtgttt
gcgctgattgaacacgagcaaaaagcgcatcgaatctataatggattgaaaggattttgc
ccagaagtgttcgtcgttcggattctcggcaaaagacattga

DBGET integrated database retrieval system