KEGG   Exiguobacterium sp. AT1b: EAT1b_1709Help
Entry
EAT1b_1709        CDS       T00897                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EAT1b_1709 (recR)
DNA repair and recombination proteins [BR:eat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EAT1b_1709 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1668122..1668721)
Genome map
AA seq 199 aa AA seqDB search
MQYPEAIGRLIESFTKLPGIGPKTAVRLAFHVLDMEEDDVLTFAKSLVSAKRDIKYCTVC
GHITDIDPCAICKDSHRDETVVCVVQDSRDVIAMEKMREYRGKYHVLHGAISPMEGIGPE
DINVSSLLTRLQENESIQEVILATNPNIEGEATSMYLSRLLKPTGIRVTRLAHGLPVGGD
LEYADEVTLSRAMEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaataccctgaagccattggacgattgattgagagttttacgaagttacctgggatt
ggaccgaaaactgcggtacgcttagcattccatgtattagatatggaagaagatgatgtg
ttgacgttcgcgaaatctctcgtgagtgcgaaacgtgacataaagtattgtaccgtatgt
ggtcacatcacggatattgacccgtgtgcaatctgcaaagactcacatcgggatgaaacg
gtagtttgtgtggttcaagactcaagagacgtgattgctatggagaagatgcgggagtac
agagggaagtatcatgttcttcatggagccattagtccaatggaagggattggtccagag
gatattaatgtttcaagtttgctgacacgtttacaagagaacgagtcgattcaagaagtg
attttagcgaccaacccgaacattgaaggggaagcgacttcgatgtatttatcgagacta
ctcaaaccgacaggcattcgcgtgacgcgtctcgcccatggtctaccagtcggtggagat
ttggagtatgcggatgaagtgacactatctcgggcgatggaaggtagaagagagctatga

DBGET integrated database retrieval system