KEGG   Exiguobacterium sp. AT1b: EAT1b_1714Help
Entry
EAT1b_1714        CDS       T00897                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eat00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eat00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1672422..1673093
Genome map
AA seq 223 aa AA seqDB search
MKLIDKYNIPNDTIITIGGMVGIGKSTITNSLADALNFRTSLEKVDTNPYLDKFYHDFER
WSFHLQIYFLAERFKEQKKIFQYGGGFIQDRSIYEDTGIFAKMHYEKGTMSPTDYETYSS
LFEAMVLTPFFPHPDLLIYLEGSFEQVLERIQMRGREMEQQTPIAYWEEMYARYTEWINN
FNLCPVLRLSIEEYDLINDPDSVELILEKIEKQLTIAREAKVR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgattgataaatataacatcccgaacgatacgatcattacaatcggtggaatg
gttgggatcgggaaatcaacgatcaccaattcgttagccgatgcattgaatttccgaacg
tctctcgaaaaagtagatacgaacccttacctcgataaattctatcatgatttcgagcgt
tggagcttccatcttcaaatttacttcttggcagaacgttttaaagaacagaagaaaatc
ttccaatacggtggcggcttcatccaagatcgttcaatctatgaagatacaggcatcttc
gccaagatgcactatgaaaaagggacgatgtcaccaacagactacgaaacgtattctagt
ttgttcgaggcaatggtgttgacaccgttcttcccgcacccggatctattaatctatctc
gaaggttcgttcgaacaagtacttgaacgcattcaaatgcgcggtcgcgagatggagcag
caaacaccaatcgcttattgggaagagatgtacgcccgctacacagaatggatcaacaac
ttcaacctgtgtccggtattgcgtctctcgattgaagagtacgacctcatcaacgaccct
gattcagtcgaactcattcttgagaaaatcgaaaagcaactcacgattgcgcgcgaagca
aaagtgagataa

DBGET integrated database retrieval system