KEGG   Exiguobacterium sp. AT1b: EAT1b_1790Help
Entry
EAT1b_1790        CDS       T00897                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_1790
   01230 Biosynthesis of amino acids
    EAT1b_1790
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_1790
  Energy metabolism
   00680 Methane metabolism
    EAT1b_1790
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAT1b_1790
Enzymes [BR:eat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EAT1b_1790
Exosome [BR:eat04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EAT1b_1790
  Exosomal proteins of melanoma cells
   EAT1b_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1757341..1757883)
Genome map
AA seq 180 aa AA seqDB search
MPTLYLIRHCSAAGQEPDASLTEAGHAQSLLLLDFFRETPIDRIISSDYTRAVASVTPLA
DMHQLPIEREPLLRERILSHEPLEDWLTPLRQSFSEPTFKLPGAESAEEATQRILQVVEH
AKAPHASTLLVTHGNLLALLLQHLDPQYDFETWRKMRNPDVYRLDYHDSTPSIEHIWPNK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcccacactctatctgattcgacactgctcggctgcaggccaagaaccggacgcttcg
ctcacggaagcaggtcacgcccagtcactactacttcttgatttctttcgtgaaaccccg
attgaccggatcatctcaagcgactacacccgagcagtcgcttcggtcacgccgctcgcc
gatatgcatcaacttccaatcgagcgtgaaccgttactgagagaacgcatcctatctcac
gaaccgctcgaagactggctgaccccattacgtcagtcgttcagcgaaccgaccttcaag
ttgcctggtgccgaatcggctgaggaggcgacgcagcgcatcctacaagtcgtcgagcac
gccaaagctccgcatgcttcgaccctattggtgacacacggcaatctgctcgcactctta
ttgcaacatctcgacccgcaatatgactttgagacatggcgtaagatgcgtaacccagat
gtctatcgtctcgattatcatgacagcacaccgtccatcgagcatatttggccaaacaaa
taa

DBGET integrated database retrieval system