KEGG   Exiguobacterium sp. AT1b: EAT1b_1832Help
Entry
EAT1b_1832        CDS       T00897                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
eat  Exiguobacterium sp. AT1b
Brite
Enzymes [BR:eat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     EAT1b_1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1804741..1805502
Genome map
AA seq 253 aa AA seqDB search
MKAVNYPVIPGAGAFYYEGNGIGILLCHGFNGTPQSVQDVGIELMKQGFTVYAPRLKGHG
THPEDFRCSTHRCWYKSVTKGIERLRESCQTVIVVGQSMGGTLALKAALEGKADAIVTIN
AALSVPGYACHASDTECRFIDEDAPDILADGVYEIVYDRVPTRAIRELLSLIDEVRPHVG
AVDVPTYVIHSAVDNVVPPSDSIWLFEQLQGTKEYAVLPNSYHVATMDHDWKHLSKLITT
FCEQVGARHQNAV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcaattacccagtcattcctggagcaggcgcattttattatgaaggaaac
gggatcggtattttgctttgtcacggctttaacgggacacctcaaagtgtacaggacgtc
ggaattgagttgatgaagcaagggttcacggtctatgccccgcgcttgaaagggcatggg
acacatccggaagactttcgatgttccacgcatcgatgttggtataaaagtgtgacgaaa
ggaatcgagcggttgcgcgagtcgtgtcagacggtcatcgtcgtcggtcagtcaatgggc
ggaacgttggcactcaaggctgcccttgaagggaaggcggatgcgatcgtgacgatcaat
gccgctttatcggtaccaggatatgcgtgtcatgcgtcggacaccgagtgtcgatttatc
gacgaagacgcgcccgacatcttagcagacggtgtatatgagattgtctatgaccgtgtg
cctacaagagcgattcgggaattgctttcgctgattgacgaggtgcgaccgcacgtcgga
gcagttgatgtgccgacgtatgtcatccattctgctgtcgacaacgtggtgccgccttcc
gactccatctggttgtttgagcagttacaaggaacaaaagaatacgcggtgctaccaaac
tcgtatcacgtcgcgacgatggaccatgattggaagcatttgtcgaagctgatcacgacc
ttctgtgaacaggttggggcgcgccatcaaaatgcagtgtaa

DBGET integrated database retrieval system