KEGG   Exiguobacterium sp. AT1b: EAT1b_1879Help
Entry
EAT1b_1879        CDS       T00897                                 

Definition
glycoside hydrolase family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eat00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1846345..1847790
Genome map
AA seq 481 aa AA seqDB search
MKQVSSDFLWGGATAANQLEGGYQEGGKGLSIADVMPGGKQRMKIIHDPAFDFELHDEYS
YPNHEGIDFYHRYKEDIALFKEMGFKTFRMSIAWSRIFPNGDEVEPNEEGLQFYDRVINE
LVAQGIEPLVTISHYEMPLHLAKHYGGWRDRRLVTYFERYSRVLFERYKGKVKYWLTFNE
INGAQFMPMLSLGIAVREEENTLQLTYQGLHHQLVASALATKAAREIDPSMQIGCMLIAA
PVYPYSSNPDDVWYAHDAERMMNFFCGDVHVRGKYPSFAKRFFQENGIELEMEDGDLEIL
KENTVDFFSLSYYMSRTEKAEKDQNEAEGNIMSGVKNPYLQASDWGWEIDPTGLRVILNK
LYERYELPLFIVENGLGAYDQVESDGTIHDHYRIDYLRDHLKGMIDAIEDGVEVMGYTSW
GCIDLVSASTGEYSKRYGFIYVDRHDDGTGTLERKRKESFFWYQEVIRSQGASLYEEESV
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtatcaagtgattttctatggggcggggccactgcggccaatcaactagag
ggcggttatcaggaaggcggtaaaggactttcgattgcagacgtgatgccaggtgggaaa
cagcgaatgaaaatcattcatgacccagcgtttgattttgagttacatgatgaatattca
tatccgaaccatgaaggaattgacttctatcatcgttacaaagaagatatcgcccttttt
aaggaaatgggattcaagacgttccgtatgtcgattgcctggtcacgaattttcccgaac
ggcgatgaagtggaaccgaatgaggagggactccaattctatgatcgtgtcatcaatgag
ttggtcgcccaaggcattgaaccactcgtgacgatttctcattatgagatgcccttacat
cttgcgaagcattatggagggtggcgagaccgtcgcttagtcacctatttcgaacgatac
agccgcgtcttgttcgaacgttataaagggaaggtcaaatattggttgacgttcaatgag
atcaacggagcgcagttcatgccgatgctcagtctcggaatcgcagttcgagaagaagag
aacacattacaacttacgtatcaaggacttcatcaccaactggtcgcaagtgcactcgcg
acgaaagcggcccgcgagattgacccatcgatgcaaatcggatgtatgctgattgcagct
ccggtttatccatacagctcaaacccggacgatgtttggtatgcccacgatgctgagcgg
atgatgaacttcttctgtggagatgttcacgtacgcgggaaatacccaagctttgcaaaa
cgctttttccaagagaacggcattgaacttgaaatggaagatggcgaccttgaaatccta
aaagaaaatacagttgatttcttttcgctcagttattatatgtcgcgcactgaaaaggct
gaaaaagaccagaatgaagcggaaggtaatatcatgagtggggtcaaaaatccatactta
caagcgagcgactggggatgggagattgacccgaccggacttcgtgtcatcttaaacaaa
ttatatgagcgttatgagcttccattattcatcgttgagaatggattaggtgcatatgat
caagtcgagtcggacggaacgattcatgatcactatcggattgattacttacgtgatcat
ttgaaagggatgatagacgcaatcgaagatggtgtcgaagtgatggggtacacgagttgg
ggctgtatcgatttagtgagtgcttcgacaggcgagtacagcaaacggtatggtttcatt
tatgtggatcgacatgacgacggtaccggtacgttagaacgaaaacggaaagaatcattc
ttctggtatcaagaggtgattcgttcgcaaggcgcgagcttatatgaagaggaatcagtc
aaatga

DBGET integrated database retrieval system