KEGG   Exiguobacterium sp. AT1b: EAT1b_1894Help
Entry
EAT1b_1894        CDS       T00897                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_1894
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAT1b_1894
   00630 Glyoxylate and dicarboxylate metabolism
    EAT1b_1894
Enzymes [BR:eat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     EAT1b_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1859008..1861191
Genome map
AA seq 727 aa AA seqDB search
MEHYERLDTYHIHEKLLEFVNKNVLEPHEINAFWEGVESLLERFIPVNQTLLEQRTTYER
LLQEWYSRQEEVDPIEYETFLTSIGYIEPVVEDFNIDVSNVDREIAHQAGPQLVVPLDNA
RYALNAANARWGSLYDALYGTDMIDETDGMEKGRAYNPVRGNEVIRLAKLFLDDTFPLPS
GSHKEVTRYVVRDDVAYAVIGDVEHSFADDSFVGYTGEPNELKTLMLRHHALHVALQFDR
EHPVGKVDPAGLMDIELESALSAIVDCEDSVAAVCAEDKVHLYRNWLGLMDGTLEASFQK
NGKRLSRRLNEDKRLIGKGGAEVVLPGRALLFIRNVGHLMTTDLILDAAGREVPEGIVDA
IFTSLIASRHLHRRLNSREGSIYIVKPKMHGSEEVAFTNDLFDAVEDLLDLPRHTLKVGV
MDEERRTSLNLKNCIEQVKERVVFINTGFLDRTGDEIHSSMTLGPMRRKGEMKTSPWLAA
YERLNVSTGLESGFHHQAQIGKGMWAMPDRMQDMMREKMAHIRSGATTAWVPSPTAATLH
AMHYHQLDAFDVQRELMQQPVLKHERQQLLDIPLATRIYSQEEIKEELENNLQGLLGYVV
RWVEQGVGCSKVPDIHHIGLMEDRATLRISSQHVANWLHHGICSAEQVEVTLYRMARVVD
EQNESDPNYRPMTPNVNQSIAYQAAHELVFHGLKQPNGYTEPILHRRRREFMKRQTVELN
LKGGTSS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
ttggaacactatgaacgactagatacgtatcatattcatgagaaactgctcgaatttgtg
aataaaaacgtacttgaaccccatgaaattaacgctttttgggaaggcgtcgaatcgctt
ctagagcgtttcattccagtgaatcagacacttctagagcagcgcacgacatatgagcga
ttgttacaggagtggtacagtcgccaagaagaagtcgatccaatcgaatacgagacattt
ttaacgtcgatcggctatatcgaaccggtcgtcgaagattttaatatcgacgtgtcgaat
gtcgatcgcgaaatcgcgcatcaagctggaccgcaactcgtcgtaccgttagacaatgcc
agatatgcacttaacgccgccaacgccagatggggaagtctctacgacgccctttatggg
acggacatgattgacgagacagacggtatggaaaaggggcgagcatataatcccgttcgc
ggtaatgaggttattcggttggcgaaactgtttctggatgacacgttcccgctaccatca
gggtcgcacaaggaagtgacacgatacgtcgttcgtgacgatgtcgcctatgcggtaatc
ggggacgtcgagcattcgttcgcagatgattccttcgtcggttacaccggggaaccgaac
gagttgaagacgttgatgctcagacaccatgccttacacgttgcactgcaatttgaccgc
gagcatccggtcggaaaggtcgatcctgctggactgatggacatcgagctcgaatcagcc
ctatccgcaatcgtggattgtgaggactcggtcgcagccgtttgtgcggaagacaaagtt
catctgtatcgtaattggctcggtctgatggatgggacgcttgaagcctcgttccaaaag
aatgggaagcgactctctcggcgtttaaacgaagacaagcgtttgattggaaaaggtgga
gcggaagtcgtcctcccaggacgcgcgctcttattcattcggaacgtcggacacttgatg
acgacggacttgatccttgatgcagcaggtcgcgaggtgccagaaggaatcgtggatgcc
atcttcacttcattgatcgcaagtcgccatctccatcgtcgtctcaactctcgagaagga
tcgatctatatcgtcaaaccgaaaatgcacggctctgaagaagttgcattcaccaatgac
ctgtttgacgccgtagaagatttactggatcttccgcgccatacgttaaaagtcggcgtg
atggatgaagagagacgaacgtcgctaaacttgaaaaattgtatcgagcaagtaaaagag
cgagtcgtcttcatcaacacgggctttctcgaccgtacgggagacgagattcattcctcg
atgacactcggaccgatgcgtcggaagggagaaatgaagacgtcaccttggctcgctgca
tatgaacggttgaatgtatcaaccggtctcgagagtgggttccatcatcaagcacaaatc
ggaaaagggatgtgggcgatgcccgaccggatgcaggacatgatgcgtgaaaaaatggca
cacatacgctccggggcaacgacggcatgggtgccttcaccgaccgcggcgacgctccat
gcgatgcactatcatcaacttgatgcttttgatgtacagcgagaattgatgcaacagcct
gttttgaaacacgaacgacaacagctccttgatatcccgctcgcgacgcgcatctattcg
caagaagagatcaaggaagagctcgagaacaacttgcaaggattgctcgggtacgtcgtt
cgttgggtcgaacaaggtgtcggttgttcgaaagtgccggatattcaccatatcggactg
atggaagaccgggcgacactccggatttcgagccaacacgtggccaactggttacatcac
ggcatctgttcagcggaacaagtcgaggtcaccctttatcggatggcacgagtcgtcgat
gagcaaaacgagtcagacccgaattatcgaccgatgacgccgaacgtcaatcagtcgatc
gcctatcaagccgcccacgaactcgtgtttcatgggttgaaacagccaaacgggtacacg
gagccaatcttgcatcgtcgccgccgtgaatttatgaaacgtcaaactgtggagttaaac
cttaaaggaggaacctcatcatga

DBGET integrated database retrieval system