KEGG   Exiguobacterium sp. AT1b: EAT1b_1894Help
Entry
EAT1b_1894        CDS       T00897                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_1894
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAT1b_1894
   00630 Glyoxylate and dicarboxylate metabolism
    EAT1b_1894
Enzymes [BR:eat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     EAT1b_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1859008..1861191
Genome map
AA seq 727 aa AA seqDB search
MEHYERLDTYHIHEKLLEFVNKNVLEPHEINAFWEGVESLLERFIPVNQTLLEQRTTYER
LLQEWYSRQEEVDPIEYETFLTSIGYIEPVVEDFNIDVSNVDREIAHQAGPQLVVPLDNA
RYALNAANARWGSLYDALYGTDMIDETDGMEKGRAYNPVRGNEVIRLAKLFLDDTFPLPS
GSHKEVTRYVVRDDVAYAVIGDVEHSFADDSFVGYTGEPNELKTLMLRHHALHVALQFDR
EHPVGKVDPAGLMDIELESALSAIVDCEDSVAAVCAEDKVHLYRNWLGLMDGTLEASFQK
NGKRLSRRLNEDKRLIGKGGAEVVLPGRALLFIRNVGHLMTTDLILDAAGREVPEGIVDA
IFTSLIASRHLHRRLNSREGSIYIVKPKMHGSEEVAFTNDLFDAVEDLLDLPRHTLKVGV
MDEERRTSLNLKNCIEQVKERVVFINTGFLDRTGDEIHSSMTLGPMRRKGEMKTSPWLAA
YERLNVSTGLESGFHHQAQIGKGMWAMPDRMQDMMREKMAHIRSGATTAWVPSPTAATLH
AMHYHQLDAFDVQRELMQQPVLKHERQQLLDIPLATRIYSQEEIKEELENNLQGLLGYVV
RWVEQGVGCSKVPDIHHIGLMEDRATLRISSQHVANWLHHGICSAEQVEVTLYRMARVVD
EQNESDPNYRPMTPNVNQSIAYQAAHELVFHGLKQPNGYTEPILHRRRREFMKRQTVELN
LKGGTSS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
ttggaacactatgaacgactagatacgtatcatattcatgagaaactgctcgaatttgtg
aataaaaacgtacttgaaccccatgaaattaacgctttttgggaaggcgtcgaatcgctt
ctagagcgtttcattccagtgaatcagacacttctagagcagcgcacgacatatgagcga
ttgttacaggagtggtacagtcgccaagaagaagtcgatccaatcgaatacgagacattt
ttaacgtcgatcggctatatcgaaccggtcgtcgaagattttaatatcgacgtgtcgaat
gtcgatcgcgaaatcgcgcatcaagctggaccgcaactcgtcgtaccgttagacaatgcc
agatatgcacttaacgccgccaacgccagatggggaagtctctacgacgccctttatggg
acggacatgattgacgagacagacggtatggaaaaggggcgagcatataatcccgttcgc
ggtaatgaggttattcggttggcgaaactgtttctggatgacacgttcccgctaccatca
gggtcgcacaaggaagtgacacgatacgtcgttcgtgacgatgtcgcctatgcggtaatc
ggggacgtcgagcattcgttcgcagatgattccttcgtcggttacaccggggaaccgaac
gagttgaagacgttgatgctcagacaccatgccttacacgttgcactgcaatttgaccgc
gagcatccggtcggaaaggtcgatcctgctggactgatggacatcgagctcgaatcagcc
ctatccgcaatcgtggattgtgaggactcggtcgcagccgtttgtgcggaagacaaagtt
catctgtatcgtaattggctcggtctgatggatgggacgcttgaagcctcgttccaaaag
aatgggaagcgactctctcggcgtttaaacgaagacaagcgtttgattggaaaaggtgga
gcggaagtcgtcctcccaggacgcgcgctcttattcattcggaacgtcggacacttgatg
acgacggacttgatccttgatgcagcaggtcgcgaggtgccagaaggaatcgtggatgcc
atcttcacttcattgatcgcaagtcgccatctccatcgtcgtctcaactctcgagaagga
tcgatctatatcgtcaaaccgaaaatgcacggctctgaagaagttgcattcaccaatgac
ctgtttgacgccgtagaagatttactggatcttccgcgccatacgttaaaagtcggcgtg
atggatgaagagagacgaacgtcgctaaacttgaaaaattgtatcgagcaagtaaaagag
cgagtcgtcttcatcaacacgggctttctcgaccgtacgggagacgagattcattcctcg
atgacactcggaccgatgcgtcggaagggagaaatgaagacgtcaccttggctcgctgca
tatgaacggttgaatgtatcaaccggtctcgagagtgggttccatcatcaagcacaaatc
ggaaaagggatgtgggcgatgcccgaccggatgcaggacatgatgcgtgaaaaaatggca
cacatacgctccggggcaacgacggcatgggtgccttcaccgaccgcggcgacgctccat
gcgatgcactatcatcaacttgatgcttttgatgtacagcgagaattgatgcaacagcct
gttttgaaacacgaacgacaacagctccttgatatcccgctcgcgacgcgcatctattcg
caagaagagatcaaggaagagctcgagaacaacttgcaaggattgctcgggtacgtcgtt
cgttgggtcgaacaaggtgtcggttgttcgaaagtgccggatattcaccatatcggactg
atggaagaccgggcgacactccggatttcgagccaacacgtggccaactggttacatcac
ggcatctgttcagcggaacaagtcgaggtcaccctttatcggatggcacgagtcgtcgat
gagcaaaacgagtcagacccgaattatcgaccgatgacgccgaacgtcaatcagtcgatc
gcctatcaagccgcccacgaactcgtgtttcatgggttgaaacagccaaacgggtacacg
gagccaatcttgcatcgtcgccgccgtgaatttatgaaacgtcaaactgtggagttaaac
cttaaaggaggaacctcatcatga

DBGET integrated database retrieval system