KEGG   Exiguobacterium sp. AT1b: EAT1b_1896Help
Entry
EAT1b_1896        CDS       T00897                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_1896
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EAT1b_1896
Enzymes [BR:eat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     EAT1b_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1861560..1862837
Genome map
AA seq 425 aa AA seqDB search
MKKREELLNSWKSERFEGVERPYSVEDVMKLRGSIVIEHTLATKGAERLWQLMHERDYVH
ALGALTGNQAIQQVKAGLEAIYLSGWQVAADANLSGHMYPDQSLYPANSVPSVVKRINQA
LQRADQIQTAEGKGDTHWFAPIVADMEAGFGGVLNVFELTKAMIEAGAAGVHLEDQLSSE
KKCGHLGGKVLLPTQTAVKNLISARLAADVMGVPTIIVARTDAHAANLITSDIDPIDHPF
IIGERTPEGFYRTEAGIEQAIARGLAYAPYADLVWCETSEPDLAEARQFAEAIHAKYPGK
LLAYNCSPSFNWKKKLSDEEIATFQQEIGAMGYKFQFVTLAGFHALNFGMFELARGYKDR
GMAAYSELQQAEFAAEVHGYTATRHQREVGTGYFDEVSLVISGGQSSTTALAGSTETEQF
ETPLH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgcgaagaattgttgaacagctggaagtcagaacgatttgaaggggtagaa
cgtccatactctgtagaagacgtcatgaaattacgagggtctatcgtaattgaacataca
cttgcgacaaagggagcggaacgcctgtggcaattgatgcacgagcgtgactacgtccat
gcactaggtgcgttgacagggaaccaggcgattcagcaagtgaaggcaggactcgaagcc
atctatttgagtggttggcaagtagcggcggatgcgaacctgtcaggtcacatgtatccg
gaccagagtctatatccggccaactcagtgccaagtgtcgtcaaacgaatcaaccaagcg
cttcaacgtgctgaccaaattcaaacggcagaagggaaaggcgacacgcattggttcgca
ccgattgtcgcggatatggaagccggttttggtggggtgctcaacgtattcgaactgacg
aaggcgatgattgaagcgggggctgccggcgttcacctcgaagaccagctctcgtctgag
aagaaatgtggtcacctcggtgggaaggtattactcccgacgcagacggctgtgaaaaac
ttgatttcggctcgactcgcggcagacgtcatgggtgtcccgacaatcatcgtagcgcgg
acagatgcgcacgcggcgaacttgatcacgagcgacatcgacccaatcgatcatccgttc
atcattggagagcgtacgccggaaggcttctatcgtacggaagctggtatcgagcaagca
atcgctcgtggtctcgcttatgcaccgtatgcagacctcgtctggtgtgagacgtccgaa
ccagatttggcagaggcacgtcaatttgccgaagcgattcatgcgaagtatccaggcaaa
cttctcgcttacaactgctcgccatcgttcaactggaagaagaagctgtcagacgaagag
atcgccacgttccaacaagaaatcggcgcaatgggctacaagttccagttcgttacactc
gctggattccacgcgctcaacttcggcatgttcgagctcgcacgcggttacaaagatcgt
ggcatggcggcttactcggagttacagcaagcagaatttgcggctgaagtacatggttac
acggcgacacgtcatcagcgtgaagtcggaacgggttacttcgatgaagtctcgctcgtc
atctcaggtggacaatcatcaacgacagcgctcgcaggttcgaccgagactgaacagttt
gaaacaccgttgcattga

DBGET integrated database retrieval system