KEGG   Exiguobacterium sp. AT1b: EAT1b_2188Help
Entry
EAT1b_2188        CDS       T00897                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_2188
Enzymes [BR:eat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EAT1b_2188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2124623..2126029)
Genome map
AA seq 468 aa AA seqDB search
MKMPKDFLFGAASASYQVEGAWNEDGKGLSNWDVFSKIPGKTFENTNGDVAVDHYHRYKE
DIALMAEMGLESYRFSISWPRIFPNGTGEVNEKGLEFYNNLIDECLKHDIVPFVTLYHWD
LPQALEEKGGWKNKETVDAFVRFADTCFQSFGDRVNHWITFNEAVIFCSLGYLTGAHPPG
IEGDVKGYFQTTHNVFVAHARAVELFKQNGHTGEIGITHVFNPAFSIDDAEENKFAEMHA
NAYATHWFYDPILKGEYPEYVVNGLSEQGLLPEMTEEELDVLKRTAPMNDFIGLNYYSPQ
RVMKNDSALVMAGGRENSTGRPGNPSFDGVYKTVKMDDKVYTKWDWEISPEAFLAGMHML
KDRYGDVKIYITENGLGDVDPIVDGEIMDTPRIEYIEGHLRAVKHAVQQGINVAGYYAWS
VIDLLSWLNGYKKQYGFIYVDHNNGLARKKKQSFHWYKEIIATRAEDL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatgcctaaagatttcttgttcggcgctgcttcggcctcttaccaggtcgaaggc
gcatggaacgaggacgggaaaggcctctcgaactgggacgtcttctcgaaaattcctggt
aagacatttgaaaacacaaacggcgacgtcgcagtcgaccattaccatcgttataaagaa
gatatcgcgctcatggcggagatgggactcgaatcgtatcgtttctccatctcatggccg
cgtatcttcccgaacggtacgggtgaagtgaacgaaaaaggactcgagttctataacaac
ttgatcgacgaatgtttgaaacatgacatcgtcccattcgtcacgctctaccattgggac
ctcccacaagcacttgaagaaaaaggcggctggaagaacaaagagacagttgacgcattc
gtccgtttcgcagatacttgcttccaatcgttcggtgaccgtgtcaaccactggatcacg
ttcaacgaagcggtcatcttctgctcacttggatacttaacaggcgcacacccgccaggt
atcgaaggcgacgtcaaaggatatttccaaacgacacataacgtcttcgtcgctcacgcc
cgtgccgttgagctcttcaaacaaaacggtcatactggcgaaatcgggatcacacacgtg
ttcaacccggcgttcagtatcgatgacgcagaggagaacaagtttgccgaaatgcatgcg
aacgcttatgcgacacattggttctatgacccgatcttgaaaggtgaatatccagagtac
gtcgtgaacggtctaagcgaacaaggcctccttcctgaaatgacggaggaagaactcgac
gtcttgaaacgtaccgctccgatgaacgactttatcggtctcaactactacagcccgcag
cgcgtcatgaagaatgactcggcgctcgtcatggccggtggacgtgagaactcgacaggt
cgtccgggtaacccatcgttcgatggcgtctacaagacggtcaagatggatgacaaagta
tatacgaagtgggattgggagatctcaccggaagcgttcctcgctgggatgcacatgctg
aaagatcgttacggcgacgtcaaaatctatatcacagagaacggtctcggtgatgtcgac
ccaatcgtcgacggtgagatcatggacacgccacggatcgagtacatcgaaggacacctt
cgtgcagtcaaacatgctgttcaacaaggcatcaacgttgccggttactatgcttggtct
gtaatcgacctactcagctggttgaacggttataagaaacaatacggcttcatctatgtc
gaccacaacaacggtctcgcacggaagaagaaacagtcgttccattggtataaagagatc
atcgccacgcgcgctgaagacctataa

DBGET integrated database retrieval system