KEGG   Exiguobacterium sp. AT1b: EAT1b_2251Help
Entry
EAT1b_2251        CDS       T00897                                 

Definition
Glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eat00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:eat00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:eat00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2205041..2205982
Genome map
AA seq 313 aa AA seqDB search
MNVLEQQLNHLVDECRPYTAQGKVADYIPELAHVKNDLLGVAICLPDGTYIHAGDVHHKF
TIQSVSKALTLCYVLMEFGEDYVFSKVGMEPTGDAFNSIAKLEETVPSKPLNPMINAGAL
AVTSMILGETAELKIYQFRQFLATLLNRSVEEVTYDEKVARSEYETTDLNRALLYFMRHH
GIVEGDVDEIIDVYTKQCAIEIDCFDLARIGRVFAGNGEDPDTGEELIPRRVVRIVKAIM
TTCGMYDASGEFAVRVGLPGKSGVSGAILAVGNHELDLNNVGFGIFGPALDSKGNSIAGM
KLLELLIERYTSR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtactcgaacaacagttgaaccacttggttgatgagtgtcgtccgtacacggct
caagggaaagtggcggactatatccctgaactcgcacatgtgaaaaacgatttactcggg
gtggcgatttgtttgccggatggtacgtatattcacgcgggggatgttcatcacaagttt
acgattcagagcgtatcgaaggcgctcacactttgttatgtattgatggagttcggggag
gactatgtcttttcgaaagtagggatggagccgacgggggacgcattcaactccatcgcc
aaactcgaggaaacggtcccgtcaaaaccactgaatccgatgatcaacgccggagcgtta
gcggtgacgagtatgattttgggggagacggcagaactcaaaatctatcagttccgccag
tttttagcgacgttgttaaatcgctcggtcgaggaggtcacgtacgacgaaaaagtcgcc
cgctctgaatacgagacgaccgacttgaaccgtgccttgctctatttcatgcgtcaccat
ggaattgtggaaggtgacgtggatgagatcattgatgtgtatacgaaacagtgtgccatt
gagattgattgttttgatttggcacgaatcgggcgtgtctttgcagggaatggagaagac
ccggatacgggcgaagagttgattccacgccgggtcgtccgaatcgtcaaggccatcatg
acgacgtgtggcatgtatgatgcatcgggtgagttcgctgtccgggttggtcttccagga
aaaagtggggtgtcgggtgccatcttggcggtcgggaaccacgaactagatttaaataac
gtcgggtttggcatatttggtccggcacttgattcaaaaggaaactcgattgccggaatg
aagttgttggaactattgattgagcgctatacttctcgctaa

DBGET integrated database retrieval system