KEGG   Exiguobacterium sp. AT1b: EAT1b_2251Help
Entry
EAT1b_2251        CDS       T00897                                 

Definition
Glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAT1b_2251
   00330 Arginine and proline metabolism
    EAT1b_2251
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EAT1b_2251
Enzymes [BR:eat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     EAT1b_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2205041..2205982
Genome map
AA seq 313 aa AA seqDB search
MNVLEQQLNHLVDECRPYTAQGKVADYIPELAHVKNDLLGVAICLPDGTYIHAGDVHHKF
TIQSVSKALTLCYVLMEFGEDYVFSKVGMEPTGDAFNSIAKLEETVPSKPLNPMINAGAL
AVTSMILGETAELKIYQFRQFLATLLNRSVEEVTYDEKVARSEYETTDLNRALLYFMRHH
GIVEGDVDEIIDVYTKQCAIEIDCFDLARIGRVFAGNGEDPDTGEELIPRRVVRIVKAIM
TTCGMYDASGEFAVRVGLPGKSGVSGAILAVGNHELDLNNVGFGIFGPALDSKGNSIAGM
KLLELLIERYTSR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtactcgaacaacagttgaaccacttggttgatgagtgtcgtccgtacacggct
caagggaaagtggcggactatatccctgaactcgcacatgtgaaaaacgatttactcggg
gtggcgatttgtttgccggatggtacgtatattcacgcgggggatgttcatcacaagttt
acgattcagagcgtatcgaaggcgctcacactttgttatgtattgatggagttcggggag
gactatgtcttttcgaaagtagggatggagccgacgggggacgcattcaactccatcgcc
aaactcgaggaaacggtcccgtcaaaaccactgaatccgatgatcaacgccggagcgtta
gcggtgacgagtatgattttgggggagacggcagaactcaaaatctatcagttccgccag
tttttagcgacgttgttaaatcgctcggtcgaggaggtcacgtacgacgaaaaagtcgcc
cgctctgaatacgagacgaccgacttgaaccgtgccttgctctatttcatgcgtcaccat
ggaattgtggaaggtgacgtggatgagatcattgatgtgtatacgaaacagtgtgccatt
gagattgattgttttgatttggcacgaatcgggcgtgtctttgcagggaatggagaagac
ccggatacgggcgaagagttgattccacgccgggtcgtccgaatcgtcaaggccatcatg
acgacgtgtggcatgtatgatgcatcgggtgagttcgctgtccgggttggtcttccagga
aaaagtggggtgtcgggtgccatcttggcggtcgggaaccacgaactagatttaaataac
gtcgggtttggcatatttggtccggcacttgattcaaaaggaaactcgattgccggaatg
aagttgttggaactattgattgagcgctatacttctcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system