KEGG   Exiguobacterium sp. AT1b: EAT1b_2539Help
Entry
EAT1b_2539        CDS       T00897                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_2539
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAT1b_2539
  Amino acid metabolism
   00310 Lysine degradation
    EAT1b_2539
Enzymes [BR:eat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EAT1b_2539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2500988..2502262
Genome map
AA seq 424 aa AA seqDB search
MIEIKVPELAESITEGTVATWLKQPGDQVEKGEAIVELETDKVNIEVPADEAGVLEEQLA
GEGDTVQVGEVIARLGSGSGGGTAVATKTKTENATETKTEAPTEKKTESVEEGKKVEKRE
EHVASPGKGPIATPAARKLAREKGIDLSAVQTNDPIGRINVHDVSRHEEKPAVKEQKPAA
AAPAPQPAASGKEEERIKMTRRRQTIANRLVEVQQTAAMLTTFNEIDMSAVMALRKRRQE
KFVKDNDVKLGFMSFFTKAAVAALKRMPYLNAEIQGNEIVLKKYYDIGIAVSAPDGLVVP
VVREADRKNFGEIEKDILHLADKARNNKLGLSDLTGGTFTITNGGVFGSLLSTPILNGPQ
VAILGMHSIQLRPVAIDADTMENRPMMYVALSYDHRIVDGREAVTFLKHIKDMIEDPEQL
LFEA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaaatcaaagtaccggagttagcagagtccattacggaaggaacggtcgcgaca
tggctcaaacagccaggcgaccaagtcgaaaaaggggaagccatcgtcgagctcgagaca
gataaagtcaatatcgaagtcccggctgacgaagcgggtgtgttagaagaacaacttgcc
ggagaaggggacacggttcaagtcggtgaagtcatcgcacgtctcggttcaggttcaggt
ggtggtacggctgtcgcgacgaagacgaagacggaaaacgcgactgaaacgaagacagaa
gcaccgactgagaaaaagacggagtctgtcgaggaaggcaagaaagttgagaaacgtgaa
gaacacgttgcgagccctggtaaaggaccaatcgcgacaccggctgcacgtaaactcgct
cgtgagaaaggcattgatctctcagccgttcaaacgaatgatccaatcgggcgcatcaac
gtccatgatgtatcgagacatgaagagaaaccggctgtgaaagagcagaagccagcggca
gcagctccggcaccacaaccggctgcaagtggaaaagaagaagagcgcatcaaaatgaca
cgtcgccgtcagacgatcgcgaaccgtctcgtcgaagtgcaacagacggcagcgatgctc
acgacgttcaatgaaatcgacatgtctgcggtcatggcacttcgtaaacgtcgccaagag
aagttcgtgaaagacaacgatgtcaaactcggcttcatgtcattcttcacgaaagcagcg
gtagcggctctcaagcggatgccttacttgaacgctgaaatccaaggcaacgaaatcgtc
ttgaagaaatattatgacatcggaatcgccgtttcggctccagatggtctcgtcgttccg
gtcgtccgtgaagcggatcgcaaaaacttcggggagatcgagaaagacatccttcacctt
gcggacaaagcacgtaacaacaagctcgggttgagtgatttgacaggtggtacgttcacg
atcacaaacggtggcgtgttcggttcactcctctcaacaccaatcttgaacggaccgcaa
gtcgctatccttgggatgcactcgattcaactccgtccagtcgcaatcgatgcggataca
atggagaaccgtccgatgatgtacgtggcactctcgtatgaccaccgaatcgtagatggt
cgtgaggctgtgacattcctcaagcacattaaagacatgattgaagatccagaacaattg
ttgttcgaagcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system