KEGG   Exiguobacterium sp. AT1b: EAT1b_2539Help
Entry
EAT1b_2539        CDS       T00897                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_2539
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAT1b_2539
  Amino acid metabolism
   00310 Lysine degradation
    EAT1b_2539
Enzymes [BR:eat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EAT1b_2539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2500988..2502262
Genome map
AA seq 424 aa AA seqDB search
MIEIKVPELAESITEGTVATWLKQPGDQVEKGEAIVELETDKVNIEVPADEAGVLEEQLA
GEGDTVQVGEVIARLGSGSGGGTAVATKTKTENATETKTEAPTEKKTESVEEGKKVEKRE
EHVASPGKGPIATPAARKLAREKGIDLSAVQTNDPIGRINVHDVSRHEEKPAVKEQKPAA
AAPAPQPAASGKEEERIKMTRRRQTIANRLVEVQQTAAMLTTFNEIDMSAVMALRKRRQE
KFVKDNDVKLGFMSFFTKAAVAALKRMPYLNAEIQGNEIVLKKYYDIGIAVSAPDGLVVP
VVREADRKNFGEIEKDILHLADKARNNKLGLSDLTGGTFTITNGGVFGSLLSTPILNGPQ
VAILGMHSIQLRPVAIDADTMENRPMMYVALSYDHRIVDGREAVTFLKHIKDMIEDPEQL
LFEA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaaatcaaagtaccggagttagcagagtccattacggaaggaacggtcgcgaca
tggctcaaacagccaggcgaccaagtcgaaaaaggggaagccatcgtcgagctcgagaca
gataaagtcaatatcgaagtcccggctgacgaagcgggtgtgttagaagaacaacttgcc
ggagaaggggacacggttcaagtcggtgaagtcatcgcacgtctcggttcaggttcaggt
ggtggtacggctgtcgcgacgaagacgaagacggaaaacgcgactgaaacgaagacagaa
gcaccgactgagaaaaagacggagtctgtcgaggaaggcaagaaagttgagaaacgtgaa
gaacacgttgcgagccctggtaaaggaccaatcgcgacaccggctgcacgtaaactcgct
cgtgagaaaggcattgatctctcagccgttcaaacgaatgatccaatcgggcgcatcaac
gtccatgatgtatcgagacatgaagagaaaccggctgtgaaagagcagaagccagcggca
gcagctccggcaccacaaccggctgcaagtggaaaagaagaagagcgcatcaaaatgaca
cgtcgccgtcagacgatcgcgaaccgtctcgtcgaagtgcaacagacggcagcgatgctc
acgacgttcaatgaaatcgacatgtctgcggtcatggcacttcgtaaacgtcgccaagag
aagttcgtgaaagacaacgatgtcaaactcggcttcatgtcattcttcacgaaagcagcg
gtagcggctctcaagcggatgccttacttgaacgctgaaatccaaggcaacgaaatcgtc
ttgaagaaatattatgacatcggaatcgccgtttcggctccagatggtctcgtcgttccg
gtcgtccgtgaagcggatcgcaaaaacttcggggagatcgagaaagacatccttcacctt
gcggacaaagcacgtaacaacaagctcgggttgagtgatttgacaggtggtacgttcacg
atcacaaacggtggcgtgttcggttcactcctctcaacaccaatcttgaacggaccgcaa
gtcgctatccttgggatgcactcgattcaactccgtccagtcgcaatcgatgcggataca
atggagaaccgtccgatgatgtacgtggcactctcgtatgaccaccgaatcgtagatggt
cgtgaggctgtgacattcctcaagcacattaaagacatgattgaagatccagaacaattg
ttgttcgaagcgtaa

DBGET integrated database retrieval system