KEGG   Exiguobacterium sp. AT1b: EAT1b_2644Help
Entry
EAT1b_2644        CDS       T00897                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAT1b_2644
Enzymes [BR:eat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     EAT1b_2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2610808..2611440
Genome map
AA seq 210 aa AA seqDB search
MTASQRARLEASGLSVHHVPLIQTKETHIPPPVERFDWLVVTSQNAVPALQNLTRDVKVA
AVGEKTKRALEAEGFTVSLMPETYTGEALFKQLLDVVSTDDVVLFARGNLANTSHMSMLP
HVQDWVVYETVPVPLTPAQQQQLEIVKALLVLSPSAVEALTPYLSRFNGTWYAIGEVTER
AVRQVSTLPIRVPECYTMDALIQCVGEDFS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcttcgcaacgggcacggctcgaggcgagcggtctttccgttcatcatgtcccg
ctcattcagacgaaagagacgcacatcccgccacccgtggaacgattcgattggctcgtc
gtgacgagtcaaaacgcggtgcccgcccttcaaaatctgacgcgtgacgtcaaagtcgcc
gctgtcggggagaagacgaagcgggcgcttgaagcggaggggttcaccgtctcgctcatg
ccggagacgtatacgggtgaggcactctttaagcagttactcgatgtcgtgtcaaccgat
gacgtcgtcttgttcgcgcgtggcaatttggcgaacacgtcccatatgtcgatgttgcct
catgtacaggactgggtcgtctatgagacggttccagtgccgttgacaccggcgcaacag
caacaactcgaaatcgtaaaggcgttgctcgtcttgagcccgtcggcggtcgaggcgctc
acaccatacttgtcccgcttcaacgggacgtggtacgccatcggcgaagtgaccgaacgc
gccgtccgacaagtgtcgacgttaccgatacgagtgccagaatgttatactatggatgca
ttaatacagtgtgtaggggaggatttttcatga

DBGET integrated database retrieval system