KEGG   Exiguobacterium sp. AT1b: EAT1b_2852Help
Entry
EAT1b_2852        CDS       T00897                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EAT1b_2852
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAT1b_2852
Enzymes [BR:eat01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     EAT1b_2852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2815340..2816254
Genome map
AA seq 304 aa AA seqDB search
MNTMQTNVKPVKHFVSLDTLSLEEIMSMIEESLRYKQGDLPPLFDGKTVANLFFENSTRT
KNSFQMAERHLNMQEIPFDVTTSSVTKGETLYDTCKTLEAIGVDALVIRHPEAGYYHELV
EKLNIPVLNGGDGSGEHPSQSLLDLVTIFEEFGTFQGLNVAICGDLVHSRVARSNASVLK
RLGANVVGCSPASWWDDSMGLERKELDDILGECDVIMLLRVQHERHIMGDVFSKEAYHTQ
FGLTVERVERMKAGAIIMHPAPVNRDVEIAGSLIEHERSRIFPQMKNGVYARMSILNRAL
GGQQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgatgcaaacaaacgtgaaaccggtcaaacacttcgtcagtttggacacactt
tcccttgaggagatcatgagcatgattgaagaatcattgcgctacaagcaaggtgacctc
cccccactatttgatgggaaaacggtcgcaaacctgttctttgaaaactcgacgcgtacg
aaaaattcgtttcaaatggccgagcgccacttgaacatgcaagagattccgttcgatgtg
acgacgtcatcggtcacgaaaggggagacgctctacgatacgtgtaaaacgctcgaagcc
atcggcgtggacgcgctcgtcattcgacatccggaagcaggctattatcacgaacttgtg
gagaagttgaatatcccagtgttgaacggaggggacgggagcggggaacatccatcccaa
tcattgctcgatctcgtcaccatctttgaagagttcggaacgttccaaggattgaacgtc
gccatctgtggtgacctcgtccatagtcgggtcgcccgctcgaacgcaagcgtcttgaag
cgcctcggagcaaacgtggtcggttgtagtcctgcctcttggtgggatgactcgatgggg
ctagagcgaaaagaactcgatgacatcctaggcgaatgtgacgtcatcatgttgctccgt
gtacaacacgagcgccatatcatgggagacgtcttctcgaaagaagcgtatcacacacag
ttcggtttgacggtcgaacgcgttgagcgaatgaaagcaggcgccatcatcatgcacccg
gctccggtcaatcgggatgtagagattgccggaagtctgatcgaacatgaacggtcacgc
atcttcccacaaatgaagaatggggtgtacgcccggatgagcatcttaaatcgagcatta
ggaggacaacaatga

DBGET integrated database retrieval system