KEGG   Exiguobacterium sp. AT1b: EAT1b_2902Help
Entry
EAT1b_2902        CDS       T00897                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00020  Citrate cycle (TCA cycle)
eat00640  Propanoate metabolism
eat01100  Metabolic pathways
eat01110  Biosynthesis of secondary metabolites
eat01120  Microbial metabolism in diverse environments
eat01130  Biosynthesis of antibiotics
eat01200  Carbon metabolism
Module
eat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAT1b_2902
   00640 Propanoate metabolism
    EAT1b_2902
   00660 C5-Branched dibasic acid metabolism
    EAT1b_2902
Enzymes [BR:eat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EAT1b_2902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACQ71816
JGI: EAT1b_2902
UniProt: C4L610
Position
2865328..2866488
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKELLREFGVAVPTGYPAFTVEEAVAAAAKLDGEVKVVKAQIHAGGRGKAGGV
KLAKTDEEVKQYASEILGKTLVTHQTGPEGKVVQRLYIEEGSAIDQEFYLGLVLDRSIGR
IVIMGSSEGGMDIEEVAEHTPEKIHKEIVDPVVGLRPFQARRLAFKMEVPTKLVNEFSDM
VMKLYKVYVETDCTIAEINPLVTTKDGNVIALDAKLNFDSNALYRHSDILALRDTTEEDP
REVEASKHDLSYIALDGNIGCLVNGAGLAMATMDIIKHYGAEPANFLDVGGGATKEKVTE
AFKLILSDDQVKGIFVNIFGGIMKCDIIAEGIVAATKEIGLDLPLVVRLEGTNVDAGKRI
LDESGLAITTANSMADGAEKIAALVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaggcgaaagaattgttaagagagtttggggtagccgttccg
acgggttatccggcctttactgttgaagaagctgtggcagctgctgcgaagcttgacggt
gaagtgaaggtagtaaaagctcaaatccacgcaggtggccgcggtaaagcgggtggcgtt
aaacttgcgaagacagatgaagaagtgaagcaatatgcttcagagattctcgggaaaacg
ctcgtgacacaccaaacaggtccggaaggaaaagttgtccagcgtctctatatcgaagaa
ggttctgcgattgaccaagaattttacttagggctcgtgcttgaccgttcgatcggccga
attgtcatcatgggttcatctgaaggtggaatggacatcgaagaagtcgctgaacataca
ccagagaagattcataaagagatcgtcgacccggtcgtgggcttacgtccattccaggcg
cgtcgtctcgcattcaaaatggaagtcccgacgaaactcgtcaacgagttcagtgacatg
gtcatgaagttgtacaaagtgtacgtcgagacagattgcacaatcgcggaaatcaacccg
ctcgtcacgacgaaagacggcaacgtcatcgcgctcgatgcgaagttgaacttcgatagc
aacgcgctctatcgtcactcggacatccttgcgcttcgtgatacgacggaagaagaccca
cgtgaagtggaagcgtcgaaacacgacctcagctacatcgcactcgacggaaacataggt
tgtctcgtcaacggtgccggtcttgcgatggctacgatggatatcatcaagcattacggc
gctgaacccgctaacttcctcgacgtaggtggcggtgcgacgaaagaaaaagtaacagaa
gcattcaagttgatcttgtctgatgaccaggtcaaaggaatcttcgttaacattttcggt
ggaatcatgaagtgtgacatcatcgcagaggggattgtcgctgcgacgaaagaaatcgga
ctcgacttaccactcgtcgttcgcttagaaggaacgaacgttgatgccgggaagcgcatt
ctcgatgaatctggacttgcgatcacgacggccaactcgatggctgacggtgcagaaaaa
atcgcagcacttgttcgataa

DBGET integrated database retrieval system