KEGG   Exiguobacterium sp. AT1b: EAT1b_2902Help
Entry
EAT1b_2902        CDS       T00897                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_2902 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAT1b_2902 (sucC)
   00640 Propanoate metabolism
    EAT1b_2902 (sucC)
   00660 C5-Branched dibasic acid metabolism
    EAT1b_2902 (sucC)
Enzymes [BR:eat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EAT1b_2902 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2865328..2866488
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKELLREFGVAVPTGYPAFTVEEAVAAAAKLDGEVKVVKAQIHAGGRGKAGGV
KLAKTDEEVKQYASEILGKTLVTHQTGPEGKVVQRLYIEEGSAIDQEFYLGLVLDRSIGR
IVIMGSSEGGMDIEEVAEHTPEKIHKEIVDPVVGLRPFQARRLAFKMEVPTKLVNEFSDM
VMKLYKVYVETDCTIAEINPLVTTKDGNVIALDAKLNFDSNALYRHSDILALRDTTEEDP
REVEASKHDLSYIALDGNIGCLVNGAGLAMATMDIIKHYGAEPANFLDVGGGATKEKVTE
AFKLILSDDQVKGIFVNIFGGIMKCDIIAEGIVAATKEIGLDLPLVVRLEGTNVDAGKRI
LDESGLAITTANSMADGAEKIAALVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaggcgaaagaattgttaagagagtttggggtagccgttccg
acgggttatccggcctttactgttgaagaagctgtggcagctgctgcgaagcttgacggt
gaagtgaaggtagtaaaagctcaaatccacgcaggtggccgcggtaaagcgggtggcgtt
aaacttgcgaagacagatgaagaagtgaagcaatatgcttcagagattctcgggaaaacg
ctcgtgacacaccaaacaggtccggaaggaaaagttgtccagcgtctctatatcgaagaa
ggttctgcgattgaccaagaattttacttagggctcgtgcttgaccgttcgatcggccga
attgtcatcatgggttcatctgaaggtggaatggacatcgaagaagtcgctgaacataca
ccagagaagattcataaagagatcgtcgacccggtcgtgggcttacgtccattccaggcg
cgtcgtctcgcattcaaaatggaagtcccgacgaaactcgtcaacgagttcagtgacatg
gtcatgaagttgtacaaagtgtacgtcgagacagattgcacaatcgcggaaatcaacccg
ctcgtcacgacgaaagacggcaacgtcatcgcgctcgatgcgaagttgaacttcgatagc
aacgcgctctatcgtcactcggacatccttgcgcttcgtgatacgacggaagaagaccca
cgtgaagtggaagcgtcgaaacacgacctcagctacatcgcactcgacggaaacataggt
tgtctcgtcaacggtgccggtcttgcgatggctacgatggatatcatcaagcattacggc
gctgaacccgctaacttcctcgacgtaggtggcggtgcgacgaaagaaaaagtaacagaa
gcattcaagttgatcttgtctgatgaccaggtcaaaggaatcttcgttaacattttcggt
ggaatcatgaagtgtgacatcatcgcagaggggattgtcgctgcgacgaaagaaatcgga
ctcgacttaccactcgtcgttcgcttagaaggaacgaacgttgatgccgggaagcgcatt
ctcgatgaatctggacttgcgatcacgacggccaactcgatggctgacggtgcagaaaaa
atcgcagcacttgttcgataa

DBGET integrated database retrieval system