KEGG   Enterobacter asburiae L1: DI57_08035Help
Entry
DI57_08035        CDS       T03084                                 

Definition
glycosidase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
eau  Enterobacter asburiae L1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DI57_08035
Enzymes [BR:eau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DI57_08035
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     DI57_08035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1696593..1698218
Genome map
AA seq 541 aa AA seqDB search
MTDWHTRAIIYQIDTALFYDLNGDGCGDIAGIAAKLRYIRRMGATVIWITPFYLTPFLDE
GYDVSDHLQVDPRFGKLADIIAFIEQARELGMQVIIELLIQHTSDAHPWFQQARRSPASP
YRDYYLWSDSDEDDTPPMFPGVEKSIWTWDDEAGQYYRHMFYRHEPDLNLTSPAVLKEIE
NIILFWLKLGVSGFRLDAASHLTTQAGNGDEKKGLWILEHMRRLIEERNPDAILLGEVDV
DVETYKDYFGNNDRLNLVLNFWLNKYFYVSLARKSARPLRNAVKKMIVPPDACCFANWLR
NHDELDLEGISQKDKQFVLDTFAPDEEMNVYQRGIRRRLAPMLNGDRKRLAFCHAVLFSL
PGVPVMRYGDEIGMGDDLELEERYAVRTPMQWAGSQGGGFSAADPEKFIAPIIDHGPYRY
QKVNVADSLLHHNSLLHRIIDIANTRSEFPEIAVAPFRLITIDDDAVLGLYYETDERSIL
TFVNFSDQPVQFTAKGIRNATWTACLEDKRYDDALICGKTVQLTLGGYGYRWFWTHRSAL
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacggactggcatacacgagccattatttatcagattgataccgcgctattttatgat
ttgaacggcgatggctgcggggacatcgccgggatcgcggccaagctgcgctatattcgc
cgcatgggggcgacggtcatctggatcaccccgttttatctcacgccctttctcgatgaa
ggctacgacgtcagcgaccacctccaggtggatccccgcttcggaaaactggccgatatc
atcgcctttatcgaacaggcccgcgagctgggcatgcaggtgattatcgagctgctgatc
cagcacacgtcggacgcgcatccctggttccagcaggcgcgccgcagcccggcgtcaccc
tatcgtgattactacctctggtcggatagcgacgaggacgatacgccccccatgtttccc
ggcgtggaaaagagcatctggacctgggacgacgaggcgggacaatactaccggcacatg
ttttatcgccacgagccggatctgaaccttacctcgcccgcggtgcttaaagagattgag
aacatcatcctcttctggctcaagcttggcgtgtcgggatttcgcctcgatgccgcatcc
cacctcaccacccaggcaggtaacggtgatgaaaaaaaggggctgtggatcctcgaacat
atgcggcgtcttatcgaagagcgcaatccggacgcgatcctgctgggtgaagtggacgta
gacgttgagacctataaagactacttcggcaataatgaccgcctgaatctggtgctgaat
ttctggctcaacaagtatttctacgtcagcctggccagaaaaagcgcccgcccgctgcgc
aatgcggtgaagaagatgatcgtcccgcctgatgcctgctgttttgctaactggctgcgc
aaccacgacgagctggatctggaaggcattagtcagaaagacaaacagtttgtcctcgac
acgtttgcccctgacgaagagatgaacgtctatcagcgcgggatccgccgccgcctggcg
ccgatgctcaacggcgatcggaagcggctggcgttctgccacgcggtgctgttttccctg
ccgggtgtcccggtgatgcgctacggcgacgagataggcatgggtgacgacctggagctg
gaggagcgttacgccgttcgcaccccgatgcagtgggcggggtcacagggaggcggtttc
tccgcagcagaccctgaaaaatttatcgcaccgattatcgaccacggcccttaccgctat
cagaaagtcaacgtcgccgattcgctgcttcaccacaactcccttctgcaccggatcatc
gatattgctaatacccgctcggagttccccgaaattgccgttgcgccctttcgccttatc
acaatcgatgatgacgcggtgctggggctctattacgagaccgacgagcgcagcatcctg
accttcgtcaacttcagcgaccagccggtgcagttcaccgcaaaagggatccgcaacgcc
acctggaccgcctgtctcgaggacaagcgctacgatgacgcgctgatttgcggcaaaacc
gttcagctcactcttggcggctacggctatcgctggttctggacgcaccgtagcgcgctg
cgctga

DBGET integrated database retrieval system