KEGG   Enterobacter asburiae L1: DI57_08945Help
Entry
DI57_08945        CDS       T03084                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
eau  Enterobacter asburiae L1
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eau00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DI57_08945
   00650 Butanoate metabolism
    DI57_08945
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DI57_08945
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DI57_08945
Enzymes [BR:eau01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DI57_08945
Amino acid related enzymes [BR:eau01007]
 Aminotransferase (transaminase)
  Class III
   DI57_08945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1899282..1900553
Genome map
AA seq 423 aa AA seqDB search
MSNQEFHQRRLSATPRGVGVMCDFFARTAENATLTDVEGNDYIDFAAGIAVLNTGHRHPE
LVAAVEKQLHQFTHTAYQIVPYESYVSLAEKLNELAPVQSPAKTAFFTTGAEAVENAIKI
ARAHTGRPGVIAFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVYHVPYPSELHGITTQ
DAITAIERLFKADIEAKQVAAIIFEPIQGEGGFNVAPAELVAAIRRICDEHGIVMIADEV
QSGFARTGKLFAMEHYADKPDLMTMAKSLAGGMPLSGVVGRAGIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDSESLCARARHLGDRLTATLEEIQCSFPALVAIRGRGSMIAAEFFD
PESREPSAAIAQAIQQKALAQGLLLLICGQYGNVIRFLYPLTIPDAQFNQALAILQQVMR
DKD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccaggaatttcatcagcgcagactttctgccaccccgcgcggcgtaggcgta
atgtgtgatttctttgcccgcacggcggagaatgccacgcttaccgacgtggaaggcaac
gactatattgatttcgccgccgggatcgcggtattgaataccggccatcgtcaccctgaa
ctggtggccgcagtggaaaaacagcttcaccagttcacccatacggcctatcagattgtg
ccgtacgaaagctacgtttcattagctgaaaagcttaacgagctggccccggtgcagagc
ccggccaagacggcgttcttcacaacgggcgcggaagcggtagaaaatgcgattaaaatc
gcccgggcccacaccggcagaccgggtgtgattgccttcgggggaggctttcacggccga
acctatatgaccatggcgttaaccggcaaggtcgcgccctataagctgggatttggcccc
ttcccggggtcggtttatcacgtgccgtatccctccgagctgcacggcattacgacgcag
gatgccatcacggcgattgagcgcctgttcaaagcggatattgaggcgaaacaggtggcg
gcgattatttttgaacccattcagggtgaaggcggattcaacgtcgccccggcagagctg
gtggccgctatccgccgtatctgcgatgagcacgggatcgtgatgattgccgacgaagtg
cagagcggcttcgcccgtacgggtaaactgtttgccatggaacactacgcggacaagccc
gacctgatgacgatggctaaaagcctggcaggcggaatgccgctgtccggcgtggtgggc
cgcgccgggatcatggacgcgccggcgcccggcggtctggggggaacctatgcaggcaac
ccgcttgcggtggccgccgcgcacgcggtgctgaatattatcgacagcgagtcactgtgc
gcgcgcgcccgtcatctgggcgatcgactgacagccacgctggaggagattcagtgcagc
tttcctgcgctcgtggcgattaggggaagaggatcgatgattgcggcggagttttttgat
cccgagagccgcgaaccttcggccgccatcgcgcaggcgatccagcaaaaggcgctcgcc
cagggcctgctgctgctgatctgcggccagtacggaaacgtgatccgcttcctttacccg
ctgaccattccggatgcccagttcaaccaggcgctggcgatcctgcaacaggttatgcgt
gataaggactaa

DBGET integrated database retrieval system