KEGG   Enterobacter asburiae L1: DI57_17715Help
Entry
DI57_17715        CDS       T03084                                 

Gene name
malS
Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
eau  Enterobacter asburiae L1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DI57_17715 (malS)
Enzymes [BR:eau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DI57_17715 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3745382..3747412
Genome map
AA seq 676 aa AA seqDB search
MKRTALAFLMLPALAHADWSSPGFNAFSAEGTGVFTSQAKLAKGTRPLTLSFDKTCWQPA
DAIKLNEMLSLKPCDGTPPQWRLFRDGDYQMRIDTRSGTPTLLLTIQSASEQPVANVIRQ
CPKWDGKPLTLDVSSTFPEGSMVRDYYSKQTATVQNGKITLQPAANSNGLLLLERAETDK
PAPFSWQNATVYFVLTDRYVNGDHGNDNSYGRHKDGMQEIGTFHGGDLKGLAGKLDYLKQ
LGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYTQDWTKLDANMGTEDDLRHLVDEA
HKRGIRVLFDIVMNHVGYATLADMQEFQFGALYLQGDELKKTLGERWTDWKPGAGQSWHS
FNDYINFSDKVAWEKWWGKKWIRTDIGDYDNPGFDDLTMSLAFLPDLKTESTTPSGLPNF
YQHKPDTHAKAIPGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELAAWQQLKDQASQA
LAAWKGANPDKKLDNAPFWITGESWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAD
MDLTWQQMAEKLQSFNVLSYLSSHDTRLFREGGQRAAELLLLAPGSVQIYYGDESERPFG
PTGSDPLQGTRSDMNWQDVTGKQALTVAHWQTLGQFRARHPAIGEGKQTTLSLKEGYGFV
REHKGDKVMVVWAGNQ
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaccgcattagcctttctgatgttacccgcactggcgcatgccgactggtca
tcgccggggtttaacgcatttagcgccgaaggcaccggcgtcttcactagccaggcaaag
cttgcgaagggtacgcgtcctctgacgctgagttttgacaagacgtgctggcagcctgcg
gatgcgataaaactcaatgagatgctgtcgctcaagccctgtgacggcacgccgccgcag
tggcgccttttccgcgacggtgactaccagatgcggattgatacccgctccggcacgccc
accctgctgctgacgattcagagtgcctcagaacagccggttgcaaacgtcattcgccag
tgtccgaagtgggacggcaaaccgctgacgctggacgtcagcagtaccttcccggaaggc
tccatggtgcgcgactactacagtaaacagacggcgacggtgcagaatggaaaaatcacc
ctgcagccagccgccaacagtaacggcctgctgctgcttgagcgcgccgaaaccgacaag
cctgcgccgtttagctggcaaaacgccaccgtctattttgtgctgaccgaccgttatgtg
aatggtgaccatggcaacgacaacagctacggtcgccataaagacggtatgcaggagatt
ggcaccttccacggcggggatctcaaaggacttgccggcaagctcgattatttaaagcag
ttgggagtgaacgcgctctggataagctccccgcttgagcagatccacggctgggtaggc
ggtggcaccaaaggagatttccctcactacgcctatcacggctactacacccaggactgg
accaagctcgacgccaacatgggcaccgaagatgatttacgccatcttgtcgacgaagcg
cacaagcgtgggatccgcgttctgtttgatatcgttatgaaccacgttggctatgccacg
ctggcagacatgcaggaatttcagtttggtgccctgtaccttcagggtgatgagctgaaa
aagacgctgggagaacgctggacggactggaagccgggcgcgggccaaagctggcacagc
tttaacgactacatcaactttagcgacaaagtcgcatgggagaaatggtggggcaaaaag
tggatccgcacggacatcggcgattacgacaaccctggcttcgacgatttgaccatgtcg
ctggcatttctgccggatctgaaaacggaatccacgacgccttccgggttgcctaacttt
taccaacacaagcccgacacccacgcgaaggccatcccgggatataccccgcgcgattat
ctgacccactggctgagccagtgggtacgtgactacggcatcgacggtttccgggtggat
acggcgaagcacgttgagcttgcggcctggcaacagctgaaagaccaggcaagccaggcg
ctggccgcctggaaaggggcaaatccggataaaaagctcgacaacgcaccgttctggata
accggggaatcctggggccacggggtgatgcaaagcgattattaccgccacggttttgat
gcgatgatcaactttgattatcaggaacaggcggcaaaagcggtggattgcctggccgat
atggatctcacctggcagcagatggcggaaaagctgcaaagcttcaacgtgctgagctat
ctctcatcacacgatacgcgtctgttccgcgaagggggccagcgagctgcggagctgctt
ctgttagctccgggcagcgtacaaatctattatggggatgaatccgagcgtccgttcggg
ccgacaggttctgacccgctgcaaggcacccggtcagatatgaactggcaggacgtcacg
ggcaagcaggccctaaccgtcgcccactggcaaacgctgggccagttccgcgcccgccat
ccagcgatcggtgaaggcaagcaaaccacattatcgctgaaagagggatatggcttcgtg
cgcgagcacaagggcgataaggtgatggtggtatgggcaggtaatcaataa

DBGET integrated database retrieval system