KEGG   Enterobacter asburiae L1: DI57_19105Help
Entry
DI57_19105        CDS       T03084                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eau  Enterobacter asburiae L1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:eau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DI57_19105
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DI57_19105
  Energy metabolism
   00680 Methane metabolism
    DI57_19105
Enzymes [BR:eau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DI57_19105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(4039710..4042361)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPDLNEA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYERNQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEENLGYRLPVDF
VPVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIQVLISELSMVEATPELR
ALAGEEGASEPYRFLMKKLRGQLMATQAWLEARLKGQRLPKPEGLLSQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDVRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNETREVLNTCKAIVDAPKGSVAAYVISMAKTP
SDVLGVHLLLKEAGIDYALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKASWCHIMDEL
SDISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQNELETMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVKPELWALGKELRELLEGDIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLAEEEGKEPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgcttgga
gataccatcaaagacgcgttgggggagaacatcctcgaccgcgtcgaaaccatccgcaag
ctgtctaaatcttcccgtgccggtaacgaggccagtcgtcaggagctgctcaccaccttg
cagaacctctctaacgatgagctgctgcccgttgcacgcgcattcagccagttcctgaac
ctggctaacaccgctgagcaataccacagcatttcgccaaacggcgaagcggcaagcaac
ccggaagtcattgcccgcacccttcgtaaactgaaagatcagccagacctcaacgaagcc
accatcaaaaaagcggtggagtcactttcgctggagctggtgctgaccgcacaccccact
gaaattacccgtcgtaccctgatccacaaaatggtggaagtgaacaactgtctgaagcag
ttggataataaagatattgccgactacgaacgtaaccagctgatgcgccgtctgcgccag
ctaattgcccagtcctggcacaccgatgaaattcgtaagcatcgcccaagcccggtcgac
gaagccaaatggggttttgcggtggtggaaaacagcctgtgggaaggggtgcctaactac
ctgcgcgagctgaacgaacagctggaagagaacctcggctaccgcctgccggtcgacttc
gttccggtccgcttcacctcctggatgggcggcgaccgcgacggcaacccgaacgtgacc
gcagaaatcacccgtcacgtcctgctgctgagccgctggaaagcgaccgacctgttcctg
aaagatattcaggtgctgatctccgagctgtcgatggttgaggcaacgcctgaactgcgc
gccctggccggggaagaaggtgccagcgagccgtaccgtttcctgatgaaaaaactgcgt
ggtcagctgatggccactcaggcctggctggaagcgcgtctgaaaggtcagcgcctgccg
aagccggaagggctgctcagccagaacgaacagctctgggagccgctctacgcctgctat
aaatcactgcaggcctgcgggatgggcatcatcgctaacggcgaactgctcgacaccctg
cgccgcgtgaagtgtttcggcgtgccgctggtgcgtatcgacgtacgtcaggaaagtacc
cgtcataccgaagccctgggcgagctgacccgctatctcggcatcggcgactatgaaagc
tggtccgaagccgacaaacaggccttcctgatccgcgagctgaactcgaagcgccctctg
ctgccgcgtaactgggagccaagcaacgaaacccgcgaggtgctcaacacctgtaaagcg
atcgtggacgcgccgaaaggatcggtggccgcctatgtgatctccatggcgaagacccca
tccgatgtgctgggcgttcaccttctgctgaaagaagcgggaatcgactacgctctgccg
gtcgccccgctgtttgagaccctcgacgacctgaacaacgccaacgacgtcatgacccag
ctgctgaatatcgactggtaccgcggctttattcagggcaaacagatggtgatgattggc
tattctgactccgcgaaagatgcgggcgtgatggcggcatcctgggcgcagtatcaggcg
caggacgcactgatcaaaacctgcgagaaagccggtattgaactgaccctgttccacgga
cgcggtggctcgattggccgtggcggcgcgcctgcacacgcagcgctgctgtcgcagccg
ccgggaagcctgaaaggcggcctgcgcgtcacagagcagggcgagatgatccgcttcaag
tacggtctgccggaagtgaccatcagcagcctgtcgctctacaccagcgctatcctggaa
gcaaacctgctgccgccgccggagccgaaagcatcctggtgccatatcatggacgagctg
tctgatatctcctgcgatctgtaccgcggctacgtgcgtgaaaacaaagatttcgtccct
tacttccgctcggccacgcctgagcaggagctgggtaaactgccgctgggctcacgtcct
gcgaagcgtcgcccgaccggtggcgtagagtctctgcgcgcgatcccgtggatcttcgcc
tggacgcagaaccgtttgatgctgcccgcctggctgggtgccggtgccgcgctgcaaaaa
gtggtggaagacggtaaacagaacgaactggaaaccatgtgccgcgactggccgttcttc
tctacccgtctgggcatgctggagatggtcttctcgaaagccgacctgtggctggcggaa
tactacgaccagcgtctggtgaaaccagagctgtgggcgctgggtaaagagctacgcgaa
ctgcttgaaggcgacatcaaagtggtgctggacatcgccaacgactcacatctgatggcg
gacctgccgtggattgccgagtctattcagctgcgtaacatctacaccgacccgctgaac
gtcctgcaggcagagctgctgcaccgttcgcgtctggcggaagaagaaggtaaagagccg
gatccgcgcgttgaacaggcgctgatggtgacgattgcgggtgttgctgcgggtatgcgt
aacaccggctaa

DBGET integrated database retrieval system