KEGG   Erwinia amylovora ATCC 49946: EAM_0019Help
Entry
EAM_0019          CDS       T01199                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EAM_0019 (rbsK)
Enzymes [BR:eay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EAM_0019 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37149..38078
Genome map
AA seq 309 aa AA seqDB search
MKKTGKLTVLGSINADHILNLAHFPRPGETVIGKQYQVAFGGKGANQAVAAARSGADMAF
IACVGEDDIGERIRLQLANDRIDIASVAVISGGSTGVALIFVDGDGENTIGIYAGANAAL
TPQRVVEHQLTIAEAQILLMQLESPLDSVLAAARIAHQHQTRVVLNPAPAMQLSDELLAL
VDIITPNETEAQILTGVAVNSDEDAARAAQKLHEKGITTVLITLGSRGVWLSEQGKGHCV
PAFSVAAVDTVAAGDTFNGALMTALLEQRPMTESVRFAHAAAAIAVTRRGAQPSVPWRDE
IDSFLQQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccggcaagctgaccgtcctcggcagcattaacgccgatcacattttgaat
ctggcgcactttccgcgtccgggggaaacggtgatcggcaagcagtatcaggttgcattc
ggtggtaaaggcgctaatcaggccgttgccgccgcccgcagcggcgcggatatggcgttt
atcgcctgtgtgggcgaagacgatatcggcgagcgtattcgcctgcagttggccaacgac
cgcattgatatcgcctctgtcgcggttatcagcggaggatctaccggcgtggcgctgatt
ttcgttgatggtgacggtgaaaataccatcggtatttatgccggtgccaatgccgccctg
acgccgcagcgcgtggttgagcatcagctgactattgctgaagcacagattttactgatg
cagttggagtcgccgctggatagcgtgctggcggcggcgcgtattgcccatcagcatcag
acccgggtggtgctgaatccggctccggcgatgcaactttcggatgagctgctggcgctg
gtcgatatcatcacccccaatgaaaccgaagcgcagatcctgaccggcgtggcggtaaac
agtgacgaagacgcagcccgtgccgcgcaaaagctgcatgagaaagggattaccacggta
ctgattacgcttggcagccggggcgtatggcttagtgagcagggtaaagggcactgtgtt
cccgcgttcagcgtggcagccgtcgatactgtcgcagcgggagatacctttaacggcgcg
ctgatgaccgcgttactggagcagcgcccgatgactgagtcggtgcgttttgcccatgcc
gctgcggcgattgccgtaacgcgccgtggcgcgcaaccttccgttccgtggcgtgatgaa
atagacagcttcttgcagcagcaggggtaa

DBGET integrated database retrieval system