KEGG   Erwinia amylovora ATCC 49946: EAM_0045Help
Entry
EAM_0045          CDS       T01199                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00230  Purine metabolism
eay01100  Metabolic pathways
Module
eay_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EAM_0045 (gmk)
Enzymes [BR:eay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EAM_0045 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase AAA_22 AAA_18 ABC_tran MMR_HSR1 AAA AAA_29 Dynamin_N Adeno_IVa2 AAA_23
Motif
Other DBs
NCBI-ProteinID: CBJ44720
Position
complement(75512..76135)
Genome map
AA seq 207 aa AA seqDB search
MAQGTLFIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRGIRPGENHGEHYYFVNHD
EFRSMISEEAFLEHAEVFGNYYGTSRKAIEQVLATGVDVFLDIDWQGAKQIRQKMPAARS
IFVLPPSKDELDRRLRGRGQDSEEVITKRMAQAVAEMSHYADYDYLIVNDDFDLALSDLK
TIIRAERLRMGRQKARHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggtacactttttattgtttccgcccccagcggtgcgggtaaatccagcctg
attcaggcgctgttaaaaacgcagccgctgtacgatactcaggtatccatctcacacacc
acgcgtgggattaggccgggtgaaaaccacggtgaacactattacttcgtcaatcacgac
gagtttcgcagcatgattagcgaagaggcgtttcttgaacatgctgaagtgttcggaaac
tattacggcacttcccgtaaagccattgaacaggtgttggcaaccggtgttgatgtgttt
ctggatatcgactggcagggtgctaaacagatccggcagaaaatgccggcagcacgcagt
atcttcgtattgcctccgtcgaaggacgaactggatcgtcgcctgcgtggccgcggccag
gacagcgaagaagttatcaccaaacgtatggctcaggccgttgccgaaatgagccattac
gcagattacgactacctgatcgtgaacgatgatttcgacctggcgctgtcagacttgaaa
accattattcgcgctgagcgtctgcggatgggccgtcaaaaggcccgtcatgatgcgtta
atcagcaaactattggcagactga

DBGET integrated database retrieval system