KEGG   Erwinia amylovora ATCC 49946: EAM_0111Help
Entry
EAM_0111          CDS       T01199                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAM_0111 (tpiA)
   01230 Biosynthesis of amino acids
    EAM_0111 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAM_0111 (tpiA)
   00051 Fructose and mannose metabolism
    EAM_0111 (tpiA)
   00562 Inositol phosphate metabolism
    EAM_0111 (tpiA)
Enzymes [BR:eay01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EAM_0111 (tpiA)
Exosome [BR:eay04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EAM_0111 (tpiA)
  Exosomal proteins of bladder cancer cells
   EAM_0111 (tpiA)
  Exosomal proteins of melanoma cells
   EAM_0111 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(139323..140090)
Genome map
AA seq 255 aa AA seqDB search
MRYPLVMGNWKLNGNKHMVNELIAGLRTELNGVDGCGVAIAPPVMYLDQAKQAISGSPVA
LGAQNVDVNLSGAFTGEVSAEMLKDIGARYIIIGHSERRTWHAESDEAIARKFAVLKAAG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLNSQGADAFNNVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDATVAARVIIQYGGSVNDKNAAELFAQPDIDGALVGGASLKAD
AFAAIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatccattagttatgggtaactggaaactgaacggcaacaagcacatggtcaac
gaactgatcgccggtctgcgtaccgagctgaacggcgttgatggttgtggcgtggcgatt
gctccacctgtcatgtacctggatcaggcgaagcaggccatttccggcagccctgtcgcc
ttgggtgcgcagaacgtggacgtcaatctgtctggcgctttcaccggcgaagtttctgcc
gagatgctgaaagacatcggcgcacggtacatcattattggccactccgagcgccgtacc
tggcacgcagaaagcgatgaagcgatcgccaggaaatttgccgtgctgaaagcggcgggc
ctgatcccggtgctgtgcattggtgaaaccgaagcggaaaacgaagcgggtaaaaccgaa
gaagtatgcgcacgtcagatcgatgcggtcctgaattcacagggcgctgatgcctttaac
aacgtggttattgcttacgaacccgtatgggcaatcggtaccggcaaatcagctaccccg
gctcaggctcaggcggtacacaaatttatccgcgaccatattgcaaagaaagatgcgaca
gtggccgcccgggtcatcattcagtacgggggttcggtgaacgataaaaatgcggcagag
ctgttcgctcagccggatatcgacggtgccctggtcggcggcgcatccctgaaggccgat
gctttcgcagcgatcgtcaaagccgcagcggcagcgaaaaaagcctga

DBGET integrated database retrieval system