KEGG   Erwinia amylovora ATCC 49946: EAM_0118Help
Entry
EAM_0118          CDS       T01199                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eay00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(145873..147387)
Genome map
AA seq 504 aa AA seqDB search
MTAEKKFIVALDQGTTSSRAVILDHDANIVAVSQREFQQIYPKPGWVEHDPMDIWASQSS
TLVEVLAHADISSDQIAAIGITNQRETTIVWDKHTGKPIYNAIVWQDPRTADYCAKLKQQ
GLEEYIRHTTGLVINPYFSGTKVKWILDHVEGSRERARRGELLFGTVDSWLVWKMTQGRV
HITDYTNASRTMMFNIHKLEWDRRMLELLDIPHEMLPEVKSSSEIYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFMLMNTGTEAVTSTHGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDEMKLIGDATDSEYFATKVKDTNGVYMVPAFTGLGAPYWDP
YARGAIFGLTRGANANHIIRATLESIAYQTRDVLEAMQNDANTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPEVREVTALGSAYLAGLAVGFWKDLDEVRAKSVIEREFRPGIETTQ
RNVLYAGWQKAVARAQAWEEADNS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgaaaagaaatttatcgtcgccctcgaccagggaaccaccagttcccgcgcc
gtgatcctcgaccatgacgccaacattgtcgcggtgtcgcagcgcgaattccagcaaatc
taccctaagcctggctgggttgagcatgacccgatggatatctgggcctcgcaaagctcc
acgctggtggaagtgctggcgcatgcggatatcagttccgaccagattgccgctatcggg
atcactaatcagcgtgaaaccaccattgtctgggataaacacaccggtaaaccgatctat
aacgccattgtctggcaggatccgcgcacggctgattactgcgcaaagctaaaacaacag
ggcctggaagagtacattcgccacaccaccggattagtgattaacccctacttctccggc
actaaagtgaaatggatcctggatcatgttgaaggttcgcgcgaacgcgccaggcgtggc
gaactgctgtttggcaccgtcgacagctggctggtgtggaagatgacacagggacgggtg
cacatcaccgactacaccaacgcgtcgcgtaccatgatgttcaacattcataagcttgaa
tgggatcggcgcatgctggaacttctcgatatcccgcatgaaatgctgcctgaagtgaag
tcatcctctgaaatttatggtcagaccaatattggcggtaagggcggtacgcgcatcccc
atcgcgggtattgccggtgaccagcaggcagcgctgtacggccagctgtgcgttcagccg
gggatggcgaaaaacacctacggcaccggctgctttatgctgatgaacaccggcaccgaa
gctgtcacctctacccacggcctgctgaccaccatcgcctgcggcccgcgtggtgaagtc
aactatgcgctggaaggcgcggtgtttatcggcggcgcgtcgattcagtggctgcgtgac
gagatgaagctgatcggtgacgccacagactcggaatatttcgcgacaaaagtgaaagac
accaacggcgtttatatggtgcccgccttcactggcttaggcgccccgtactgggatccc
tatgcccgtggtgccattttcggcctgacgcgcggtgccaacgctaatcatattatccgc
gccacgctggagtcgatcgcctaccaaacccgtgatgtgctggaagcgatgcagaacgat
gccaacacccgcttgcaatcgctgcgcgtggacgggggtgccgttgccaataacttcctg
atgcagttccagtccgatattctcggtacgcgcgttgagcgccctgaagtgcgtgaagta
accgcattgggatcggcttatctggcaggcctggccgttggtttctggaaggacctggat
gaagtacgtgccaagtcggtgatcgaacgcgaattccgcccgggcatcgaaaccacccag
cgtaacgtgctgtacgccggctggcaaaaagccgttgcccgtgctcaggcatgggaagag
gccgacaacagctaa

DBGET integrated database retrieval system