KEGG   Erwinia amylovora ATCC 49946: EAM_0193Help
Entry
EAM_0193          CDS       T01199                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:eay00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237334..238326
Genome map
AA seq 330 aa AA seqDB search
MKLHQKSWLTREKAFAAFATGPLLDFWRQREEGEFSGVDNVPIRYVRFISSQHDKVILLC
PGRIESYVKYPELAYDLFHSGYDVFIIDHRGQGRSGRLLKDSHRGHVVAFEDYVEDLETL
YLQEIATRHYRHRYALAHSMGGAILALMLARQPAAFDAVALSSPMFGIFLPLPLWMARRI
LNWAEKRPTVRDDYALGTGKWRARPFAINDLTHSRERYRRNVRFYADDPGIRVGGPTYHW
VREGVRAGQRVLRQAAQISTPLLLLQAANDKVVDNRAQDLFCQMMVAAGQPCQGGKPMII
EGARHEILFEQDRMRAAALEAVLAFFARHA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacaccagaaaagctggttaacgcgtgaaaaagccttcgcggcttttgccacc
ggcccgttgctggatttctggaggcagcgcgaagagggcgagttttcaggagtggataac
gtaccgatccgctacgtccgcttcatctcatcgcaacatgacaaggtgatattactgtgt
ccggggcgcattgaaagctatgtcaaatacccggagctggcctacgacctgtttcatagc
ggatatgacgttttcattatcgatcatcgcgggcaggggcgttcgggcagactgctaaag
gattcgcatcgtgggcacgttgtggcgtttgaagactacgttgaggatctggaaacgctg
tatttacaggagatcgccacacgccactatcgccatcgctatgcgctggcgcattcaatg
ggcggggcgatcctcgccctgatgttggcacgacagcctgcagcctttgacgcggtggcg
ctgtcttcaccgatgtttggcattttcctgcctttgccattatggatggcgcgccgcatt
ctcaactgggcggaaaaacgcccgacggtacgcgatgattatgcgctgggtaccgggaag
tggcgtgcgcgcccgtttgcgataaacgatctgacgcatagccgcgaacgctatcgccgc
aatgtgcgtttttatgctgacgatcccggtatacgcgttggtggcccgacctatcactgg
gtgcgggaaggcgtgcgggccgggcaacgcgttttgcgccaggccgcacagatttccacc
ccgctgctgctgctgcaggccgctaacgataaggtggtcgacaaccgtgctcaggacctg
ttctgccagatgatggtggccgcgggtcagccctgtcagggggggaagccgatgattatc
gagggtgcgcgccatgagatcctgtttgagcaagaccggatgcgcgcagcggcgcttgaa
gccgtcctcgccttttttgcccgccatgcctga

DBGET integrated database retrieval system