KEGG   Erwinia amylovora ATCC 49946: EAM_0327Help
Entry
EAM_0327          CDS       T01199                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00010  Glycolysis / Gluconeogenesis
eay00620  Pyruvate metabolism
eay00640  Propanoate metabolism
eay00680  Methane metabolism
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01120  Microbial metabolism in diverse environments
eay01130  Biosynthesis of antibiotics
eay01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAM_0327 (acs)
   00620 Pyruvate metabolism
    EAM_0327 (acs)
   00640 Propanoate metabolism
    EAM_0327 (acs)
  Energy metabolism
   00680 Methane metabolism
    EAM_0327 (acs)
Enzymes [BR:eay01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EAM_0327 (acs)
Lipid biosynthesis proteins [BR:eay01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EAM_0327 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBJ45002
Position
complement(386917..388872)
Genome map
AA seq 651 aa AA seqDB search
MSHSHIYPIPANIAQNTLINPRQYHLMYQQSIQDPEAFWGEQGKILDWIKPYATVKNTSF
APGNISIRWYEDGTLNLAANCLDRHLAARGDRPAIIWEGDDASESKTITYRELHHDVCRF
ANALQALGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSHA
RLVITADEGVRAGRTIPLKQNVDDALTDRGVTSVDKVIVLRRTGKDIHWHHGRDLWWHER
MNSASEQHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPEDI
YWCTADVGWITGHSYLLYGPLACGATTLMFEGVPNWPKPSRMAEVVDKHQVTILYTAPTA
VRALMAEGDKAIAGTHRSSLRILGSVGEPINPEAWEWFHQKIGNGRCPISDTWWQTETGG
FMIAPLPGATALKPGSATHPFFGVQPALVDNEGNLQEGASEGNLVIVDSWPGQARTLFGD
HQRFEQTYFSTFKNRYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHALKGQAIYAYITLNSGEEPSPQLYSEVRAWVRKEIGPIATPDVLHWTD
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPGVVDKLLEEKLSIKMP
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagccattcacatatttaccctatcccggccaacattgcgcaaaatacgctgataaat
ccccggcagtatcacttaatgtatcagcaatcgatacaggaccccgaggcattttgggga
gagcaaggcaagatcctggactggataaaaccttacgctacggtaaagaacacctccttt
gcccctggcaatatctccattcgctggtatgaggacggcacgcttaacctggccgccaac
tgcctcgaccggcatctggcagcgcgcggcgatcgcccggcaattatctgggaaggggat
gacgccagcgaaagcaaaaccattacttaccgcgaactgcatcacgacgtatgtcgcttt
gccaatgccctgcaagcgctgggaatcaaaaagggtgatgtggtggcgatctatatgcca
atggtgccagaagccgctgtggcaatgctggcctgcgcgcgcatcggtgccgtgcattcg
gttatctttggcggtttttcaccggaagccgtcgccgggcgaattatcgacagtcatgcc
cgtctggtgatcaccgccgacgaaggcgtgcgtgccggacgcaccattccgctgaagcaa
aacgtcgatgatgctctgactgatcgcggggtgaccagcgtcgacaaagtcattgtcctc
aggcgcaccggcaaagatattcactggcaccacggccgtgacctttggtggcatgagcgg
atgaacagtgccagcgagcagcatcagcctgaagagatgaacgcggaagacccattattc
atcctgtatacctccggttctaccggcaaaccaaagggggtgctgcataccactggcggt
tatctggtttatgccgcgaccactttcaaatacgttttcgattatcacccggaggatatc
tattggtgtaccgccgatgtcgggtggattaccggacacagttacctgctgtacggtccg
ctggcctgtggtgccaccacgctgatgtttgaaggagtgcctaactggccaaaaccaagt
cgtatggccgaagtggtggataaacaccaggtgaccatcctgtatacggcgcccacggca
gtgcgcgcgttaatggccgaaggggataaagcgattgccggcacccatcgttccagcctg
cgcatccttggctcagtaggtgaaccgatcaacccggaggcctgggagtggttccatcaa
aaaatcggtaatggccgatgccccatttcagatacctggtggcagacggaaacaggcggt
tttatgatcgctccgctccccggagccaccgcgctgaaacccggatcggctacccatcca
ttttttggcgtacagccagcgctggtcgataacgaaggtaatctgcaggaaggtgccagc
gaaggcaatctggttatcgttgattcctggcctggccaggcgcgcacgctatttggcgat
catcagcgctttgagcagacctacttctccaccttcaaaaaccgctatttcagcggcgac
ggcgctcgccgtgatgaagacggttattactggataaccggacgcgtcgacgacgtactg
aatgtttccggtcatcggctgggcacggcagagatcgagtccgcgctggtctcgcatccg
aaaattgctgaagccgccgtggtcgggattccacacgctttaaaaggccaggcaatctac
gcctatataacgctgaacagtggtgaagaaccttcgccgcagctgtacagcgaagtgcgt
gcctgggtgcgtaaagagattggccccattgctacgccggacgtgctgcactggaccgat
tcattacccaaaacccgctcggggaaaattatgcgccgtattttacgcaaaattgccacc
ggcgataccagcaatctcggcgatacttctacgctggccgatcccggcgtggtagacaaa
ttactcgaagaaaaactgtcgattaaaatgccataa

DBGET integrated database retrieval system