KEGG   Erwinia amylovora ATCC 49946: EAM_0455Help
Entry
EAM_0455          CDS       T01199                                 

Gene name
cysQ
Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:eay00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542803..543543
Genome map
AA seq 246 aa AA seqDB search
MLEKICQLAREAGDAIMQVYDGQAPLDVAQKSDDSPVTAADMAAHRVIVAGLQALTPTIP
VLSEEAPQSWEERQHWQEYWLVDPLDGTKEFIKRNGEFTVNIALIKAGKAVLGVVYAPVL
AVMYCAAEGKAWKEEGGHKIRIQVQDARPPLVVVSRSHADSELEDYLKHLGDHQTTAIGS
SLKFCLVAEGKAQLYPRFGPTNIWDTGAGHAVALAAGAHVNDWQGKPLDYAPRESFLNPG
FRVSLF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaaatttgccaactggcgcgtgaagcaggtgatgccatcatgcaagtgtat
gacgggcaggctccgctggatgtggcgcagaagtccgatgactcgccggtgacagccgca
gacatggcggcgcacagggtgatcgtcgccggattacaggcgttaacgcccaccatcccg
gtgctgtcagaagaagcgccacagagctgggaagaacgccagcactggcaggaatactgg
ctggtggatccgcttgacggcacgaaagagtttatcaaacgtaacggggagtttacggtc
aatattgcgctgatcaaagcgggaaaggcggtgctgggcgtggtctatgcgccggtactg
gcggtgatgtattgcgctgcagaaggcaaagcctggaaggaagagggcggccataaaata
aggatccaggtgcaggatgcgcggccgccgctggtggtagtcagccgttcgcatgcagac
agcgaactggaagattacctcaagcacctgggcgatcaccaaaccaccgcgattggctca
tcgctgaagttctgcctggtggcagagggaaaagctcagctttatccgcgtttcggaccg
actaatatctgggatacgggggcaggccacgcggtggcgttggcggcgggtgcgcacgtt
aatgactggcagggtaaaccccttgactatgcgccgcgcgagtcattccttaatccgggg
ttccgcgtttccctcttttga

DBGET integrated database retrieval system