KEGG   Erwinia amylovora ATCC 49946: EAM_0616Help
Entry
EAM_0616          CDS       T01199                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EAM_0616 (deoA)
Enzymes [BR:eay01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     EAM_0616 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691831..693153
Genome map
AA seq 440 aa AA seqDB search
MFLPQEIIRKKRDGHALSEEEIRQFINGVRDNSVSEGQIAALAMAIWFRDMTLPERVALT
MAMRDSGSVLSWQALNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPPDDRFRQIIKQTGVAIVGQTRSLAPADKRFYATRDITATVDSI
PLIAASILAKKLAEGLDALVMDVKVGSGALVPTLPQSEELAQAIFGVANGAGCKTTVLLT
DMNQPLASSAGNALEVREAVQFLTGGYRNPRLLEVTMALCSEMLLSGGLAKSGDEARMKL
QAVLDNGAAAGVFARMVAAQKGPADFIERIDSYLPAPMLSKAVYASTSGTVSAMDTRALG
MAVVAMGGGRRRASDSIDYSVGFSELVQLGDKVDGQRPLAVVHAASEAGWQQAAQALQHA
VVVGQVQPAPTPVIYRRISQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctgccacaagaaatcatccgcaaaaaacgtgatggtcatgcactgagcgaagaa
gagatccgtcagttcatcaacggcgtgcgtgacaactcggtttcagaggggcagatcgcc
gcgttggcgatggcgatctggttccgggatatgactctgccggagcgtgtggcgctgact
atggcgatgcgtgattccggttcggtactcagctggcaggcgctgaatctcaacggcccg
ctggtggacaaacactcaaccggcggcgttggcgacgtcacgtcgctgatgcttggcccg
atggtggccgcctgtggcggctatgtgccgatgatctccggtcgtgggcttggtcatacc
ggcggcacgctggataaactggaagccattcccggttttgatattttcccaccggacgat
cgctttcgccagattatcaaacagacaggagtggcgatcgtcggccagacccgttcgctg
gctccggcggataagcgcttctatgccacgcgtgatattaccgccacggtagattccatc
ccgcttattgctgcctcgatccttgccaagaaactggctgaaggcctggatgcgctggtc
atggacgtaaaggttggttccggggcgttggtgccgactctgccccagtctgaggagctg
gcgcaggctatttttggcgtagcaaacggtgccggttgtaaaaccaccgtgctgttaacc
gatatgaaccagccgctggcttccagtgccggtaatgcgctggaagtgcgtgaagcggtg
cagttcctgaccggcgggtatcgtaatccgcgcctgctggaagtgacgatggcgctgtgc
agcgaaatgttgctctccggcgggctggcgaagtcaggcgacgaagcgcggatgaagctg
caggcggtgctggacaacggcgccgccgccggggtgttcgcgcgcatggtggcggcgcag
aaaggcccggcggactttattgagcgtatcgacagttacctgcccgcgccgatgctaagt
aaagcggtttatgccagcaccagcggcaccgtcagcgcgatggatacccgtgcgctgggg
atggcggtagtggcgatgggcggcggtcgccgccgggccagtgacagcattgactacagt
gttggcttcagcgaactggtgcagctgggcgataaggttgatggccagcgtccgctggcg
gtggtccatgccgccagcgaagccggctggcagcaggcggcgcaggcattgcagcacgcc
gtcgttgtcgggcaggtgcagccggcgccaacgccagttatttatcgcagaatctcgcaa
taa

DBGET integrated database retrieval system