KEGG   Erwinia amylovora ATCC 49946: EAM_0644Help
Entry
EAM_0644          CDS       T01199                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EAM_0644 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAM_0644 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EAM_0644 (thrC)
Enzymes [BR:eay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EAM_0644 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
721808..723094
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGKQQGLFFPLELPEFELTDIDNMLNMDFVTRSSKILS
AFIGDEIAPHQLNERLKTAFTFPAPVVEVTDDIAALELFHGPTLAFKDFGGRFMAQMLAY
VSGADEQITILTATSGDTGAAVAHAFYGMENVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDVCQSLVKQAFDDEELKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLANGQWTPNPTVATLSN
AMDVSQPNNWPRVEEIFRRKTWRLTDLGYGAVDDETTQAAMRELADLGYLSEPHAAIAWR
LLRDGLQEGEFGLFLGTAHPAKFKESVEEILQRTLPLPDALAERADLPLLSHSMKAQFTE
LRAFLLNT
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatcttaaggatcacaacgagcaggtaagcttcgcccaggcggtgaag
caggggctgggcaaacagcagggcctgttctttcccctcgagctacctgagttcgaactg
accgatattgataacatgctgaacatggattttgtgactcgtagcagtaaaatcctctcg
gcgtttatcggggatgaaattgctccgcaccagctgaatgagcgtttgaaaacggcgttc
accttcccggcaccggtggtggaagtcactgacgatatcgccgcgttggagctgttccac
ggtccgacgctggcgtttaaagactttggcggccgctttatggcacagatgctggcttat
gtcagcggcgcagatgagcagatcactatcctcaccgccacttccggcgataccggagcc
gccgttgctcatgctttctacggcatggaaaacgtgcgcgtggtgatcctttatccacag
ggcaaaatcagtccgctacaggaaaaactgttctgtaccctcggcggtaatatcgaaact
atcgccatcgacggcgatttcgatgtttgccagtcactggttaaacaggcatttgacgat
gaagaactgaaaaaggccattggccttaattcggcgaactcgattaatatcagccgcctg
ctggcgcagatctgctactactttgaagccgttgcgcagctgccgcaggagaagcgcaat
cagctggtgatatcggtgccgagcggcaactttggtgacctgacggctggcctgctggcg
aaatctcttggcttgccggtgaagcgttttattgccgccaccaacgccaatgataccgtg
ccgcgctttctggccaacggccagtggacgccaaatcccaccgtggcaacgttgtcgaac
gcgatggacgtcagccagccaaataactggccgcgcgttgaagagattttccgccgcaaa
acctggcgcttaacggatcttggctacggtgccgtcgacgatgagaccacccaagcggcg
atgcgtgagctggccgacctcggttacctttctgagccacatgcggctatcgcctggcgg
ctgctgcgagatggattacaggaaggggagtttggcctgttccttggtactgcacacccg
gctaagtttaaagagagcgtggaagagatcctgcaacgcactttgccgctgccggatgcg
ctggccgagcgcgccgatctgccgctgctgtctcacagcatgaaagcgcaatttaccgaa
ctgcgtgcgttcctgctgaacacctaa

DBGET integrated database retrieval system