KEGG   Erwinia amylovora ATCC 49946: EAM_0671Help
Entry
EAM_0671          CDS       T01199                                 

Gene name
rluA
Definition
ribosomal large subunit pseudouridine synthase A
Orthology
K06177  
tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
eay  Erwinia amylovora ATCC 49946
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(754433..755086)
Genome map
AA seq 217 aa AA seqDB search
MEPYNPPLEPWLHVLYQDEHIIVVNKPSGLLSVPGRLAEYKDSVMTRVQRDYPAAESVHR
LDMATSGVMVVALTKAAERELKRQFREREPQKTYVARVWGHPQPESGSVDLPLICDWPNR
PKQKVCFETGKSAQTEYQVLDYASDHSARVRLKPVTGRSHQLRVHMLALGHPILGDNFYA
HDEARAMAPRLQLHAESLSITHPHYRTPMTFRQPADF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggaaccctacaatcccccgctggaaccctggctgcacgtcctctatcaggacgaacac
atcatcgtggtgaacaaacccagcggcctgctgtcggtgccgggacggcttgccgagtac
aaggacagcgtgatgacgcgcgtgcagcgtgattatccggcggcagaatcggttcaccgt
ctggatatggccaccagcggcgtgatggtggtggcgttaaccaaagccgccgagcgcgag
ctgaagcgccagttccgcgaacgcgagccgcaaaaaacctatgtggcgcgcgtttggggg
catccgcagccggaaagcggatcggtggatttaccgctgatttgcgactggccgaacagg
cccaaacagaaggtgtgttttgaaacaggtaaatctgcgcagactgaatatcaggtgctg
gactacgccagcgatcacagcgcgcgcgtccggctaaaacctgttaccgggcgctcgcac
cagctgcgcgtgcatatgctggcgcttggccatccgatcctgggcgataacttctatgct
catgatgaagcgcgggcgatggcaccgcgactgcaactgcatgccgaaagcctgagcatc
acccatccgcactaccgcacgccgatgacctttcgccagccggcagatttttga

DBGET integrated database retrieval system