KEGG   Erwinia amylovora ATCC 49946: EAM_0748Help
Entry
EAM_0748          CDS       T01199                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvat dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00010  Glycolysis / Gluconeogenesis
eay00020  Citrate cycle (TCA cycle)
eay00620  Pyruvate metabolism
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01120  Microbial metabolism in diverse environments
eay01130  Biosynthesis of antibiotics
eay01200  Carbon metabolism
Module
eay_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAM_0748 (aceF)
   00020 Citrate cycle (TCA cycle)
    EAM_0748 (aceF)
   00620 Pyruvate metabolism
    EAM_0748 (aceF)
Enzymes [BR:eay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EAM_0748 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA DUF1223
Motif
Other DBs
NCBI-ProteinID: CBJ45423
Position
843236..844831
Genome map
AA seq 531 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVKVGDTVEVEQSILVVEGDKASMEVPSPQAGVVKEIKIA
TGDRVETGKLIMIFEAAGDAAAPAAAQEKQEAAPAAPAAAPAAASAAKEVNVPDIGGDEV
EVTEIMVKVGDKVEAEQSILTVEGDKASMEVPAPFAGTVKEIKISAGDKVSTGSLVMVFD
VEGAAPAAAPAAKAEAPAPAAPVQEEKAAPAAAPAKAEAKSEFAENDAYVHATPVIRRLA
REFGVNLAKVKGTGRKSRILKEDVQSYVKDAVKRAEAPAAGGGMPGMLPWPKVDYSKFGE
VEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTP
VVFIMKAVAAALEQMPRFNSSLSEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGI
VELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSA
MEPVWNGKEFMPRLMMPISLSFDHRVIDGADGARFITIINNTLADIRRLVM
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaatgttcctgatatcggggcagacgaagttgaagtcaccgagatc
ctggtcaaggttggcgacacggtagaagttgagcagtcaatactggtggtcgaaggcgac
aaagcatcaatggaagtgccttcaccacaggctggcgtggtgaaagagatcaagattgcc
accggcgaccgggttgaaaccggtaagctgattatgatctttgaagcggcgggcgatgca
gcagcccccgccgcggcgcaagagaagcaggaagcggccccggccgcccctgctgccgcc
ccggcggcggccagcgcggcgaaagaggtgaatgtccctgatatcggcggtgatgaagta
gaagtcaccgagatcatggtgaaagtcggcgacaaggttgaagctgaacagtcaatcctc
accgttgaaggtgacaaagcctcaatggaagtgcctgcaccttttgccggtacggtaaaa
gagatcaaaatcagcgccggcgacaaagtcagcaccggttctctggtcatggtctttgac
gtcgagggcgcggcacctgccgctgctccggcggcgaaagctgaagcgccagcccctgct
gcgcctgtgcaggaagagaaagcggctccggcagcggcgcctgccaaagccgaagcgaag
tctgaatttgcagagaacgatgcctacgtgcacgccacgccggttatccgccgcctggcg
cgtgaatttggcgttaacctggcgaaggttaaaggcaccggccgcaaatcgcgtattctg
aaagaagacgtgcagagctacgtgaaagacgcggtgaaacgcgccgaagcgccagcggct
ggcggcggcatgccgggcatgctgccgtggccgaaagtggactacagcaaatttggtgaa
gttgaagaagtggagctgggccgcatccagaaaatctccggtgctaacctgagccgtaac
tgggtgatgatcccgcacgttacccacttcgataaaaccgatatcaccgatctggaagcg
ttccgtaaacagcagaatgccgaagcagagaagcgcaagctggacgtgaagttcaccccg
gtggtgttcatcatgaaagccgttgccgctgcgctggagcagatgccgcgctttaacagc
tcgctgtctgaagacgcgcagaagctgacgctgaaaaaatacatcaacatcggcgtggcg
gttgatacgccaaacggcctggtggttccggtattcaaggacgttaacaagaaaggcatt
gttgagctgtcgcgtgaactgaccaccatctccaaaaaggcgcgtgatggtaagctgacc
gcaggcgaaatgcagggcggttgcttcaccatttccagcattggcgggctgggaaccacc
cactttgcgccgatcgttaacgcgccggaagtggctatcctcggcgtttccaagtcggcg
atggagccggtatggaacggtaaagagtttatgccgcgcctgatgatgccgatctcgctc
tccttcgaccaccgcgtgatcgacggggccgatggtgcgcgctttatcaccattatcaat
aacacgctggccgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system