KEGG   Erwinia amylovora ATCC 49946: EAM_0757Help
Entry
EAM_0757          CDS       T01199                                 

Definition
(GenBank) putative thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAM_0757
   00630 Glyoxylate and dicarboxylate metabolism
    EAM_0757
   00640 Propanoate metabolism
    EAM_0757
   00650 Butanoate metabolism
    EAM_0757
  Lipid metabolism
   00071 Fatty acid degradation
    EAM_0757
   00072 Synthesis and degradation of ketone bodies
    EAM_0757
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EAM_0757
   00310 Lysine degradation
    EAM_0757
   00380 Tryptophan metabolism
    EAM_0757
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EAM_0757
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EAM_0757
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EAM_0757
Enzymes [BR:eay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EAM_0757
Exosome [BR:eay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAM_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
852236..853387
Genome map
AA seq 383 aa AA seqDB search
MIVAACRTPVGRAYGSLANVPPQALLAPLFGKLLAALPAGFTAIDEVIIGNATGGGGNIA
RLAALAAGLPLAVPGVTVDRQCGSGLEAVINACRLVQARAGECYLAGGVESVSTAPWRVE
KPATLRQMPRFYPRARFSPEEIGDPEMGIAAENVARQCAISRERQDRFALRSHQRALAAA
QQGAFREEIVALNLDRCQVENDECPRPDTSLARLAALPPVFAADGSVTAGNCCPLNDGAA
LLLVMSRRMARDCGFSQGLLFADACSAGVDPNLLGLGPVPATQKLLRRQPGLALDRVEVI
EFNEAFAAQVLASVDALGIAEHRINQQGGAIALGHPYGASGAIMVTRLFSQLVSQRQSEG
FGLAMLGIAGGLGLSALFKGVRL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtcgccgcctgccgcacgcccgtcggcagggcttatggctcgctggccaacgtg
ccgccgcaggcgctgctggccccgctgtttggcaagctgctggcggcattacccgctggg
tttacggcgattgatgaggtgattatcggcaacgccaccggcggcggcggcaatattgcc
cggctggcggcgctggcggccgggttaccgctggcggtgcctggcgtgacggtggaccgc
cagtgcggctccgggctggaagcggtgattaacgcctgtcggctggtgcaggccagggca
ggtgaatgttatctggccggcggggtagagagcgtcagcaccgcgccctggcgggtggaa
aagcccgccacgctaaggcagatgccgcgcttttatccgcgcgcacgtttttcgccggaa
gagatcggcgacccggaaatgggcatcgccgccgagaacgtggcgcgtcagtgcgccatc
agccgggaacgccaggaccgctttgcgctgcgcagccatcagcgcgcgctggccgccgcg
cagcagggcgcattccgcgaggagatcgtcgcgcttaaccttgaccgttgccaggttgaa
aacgacgaatgcccacggcctgatacttcgctggcgcggctggcggcgttaccgccggta
tttgccgccgatggctcggtgacggcgggtaactgctgcccgctgaatgacggcgctgcg
ctgctgctggtgatgagccgccgcatggcgcgggattgcggcttcagccaggggctgctg
tttgccgatgcctgtagcgcgggggttgacccgaatttactggggcttggcccggttccc
gccacgcaaaagctgctgcggcgtcagccgggcctggcgttggatcgggttgaggtgatc
gagtttaatgaggcttttgccgcccaggtgctggcatcggtagatgcgttgggcattgct
gaacacaggatcaaccagcaggggggcgctatcgcactggggcatccttacggcgcttcc
ggggcgatcatggtaacgcggctgttcagccagctggtaagtcagcggcagagcgaaggc
ttcgggctggcgatgctggggatcgccggtgggctggggttgagcgcgctgtttaagggc
gtgcggctgtaa

DBGET integrated database retrieval system