KEGG   Erwinia amylovora ATCC 49946: EAM_0790Help
Entry
EAM_0790          CDS       T01199                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EAM_0790 (folK)
Enzymes [BR:eay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     EAM_0790 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(888274..888756)
Genome map
AA seq 160 aa AA seqDB search
MINRVYLALGSNLADPLLQVQCALDALVAIPDCQLVATSSLYRTPPYGPPDQPDFLNAAV
ALDTGLDAEALLNHTQRIELEQGRVRKAHRWGPRTLDLDIMLFGEQTLNTPRLTVPHYDM
HRRAFMLLPLLEIAPALCLPDGRALADMLANLDCSSIRPW
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaccgcgtttatctggcgttgggcagtaatctggccgacccgttgcttcaggtg
caatgcgcgcttgatgcgctggtagccatacctgattgccagctggttgccacctcttcc
ctgtaccgcacgccaccctatggcccgccggatcaacccgattttctcaatgcggcagtg
gcgctcgataccgggcttgacgctgaagcgctactcaaccatacccagcgcattgagctg
gagcaggggcgcgtacgcaaggcgcatcgctggggcccgcgcacgcttgacctcgacatc
atgctgttcggtgagcagacgctaaacacccctcgcctgacggtgccgcattacgatatg
catcgtcgcgcgtttatgctgctgccgctgctggagattgctcccgcgctttgcctgccg
gacggcagagcgctggctgatatgctggctaaccttgactgtagcagcatccgcccctgg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system