KEGG   Erwinia amylovora ATCC 49946: EAM_0887Help
Entry
EAM_0887          CDS       T01199                                 

Definition
methionine salvage pathway protein E-2/E-2'
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:eay00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997812..998354
Genome map
AA seq 180 aa AA seqDB search
MSALTIFTESEATTPVWYSIDAAEIADKLRSKGVRFERWHADRDLGDNPDPETVIGAYQH
AIDRLVAEKGYQSWDVISMRADNPQKEALRSKFLSEHTHGEDEVRFFVEGAGLFCLHLDG
HIFQILCEKNDLISVPAGTPHWFDMGSSPHFTAIRIFDNQEGWIAKFTGDPIADGYPRLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactgactatttttaccgaaagcgaagcaaccaccccggtgtggtacagcatc
gatgcggctgagatcgctgataagctgcgcagtaaaggcgtgcgctttgaacgctggcat
gccgaccgtgacctcggagataatcccgatcccgaaacggtgatcggcgcttatcagcat
gccatcgaccggctggtggcggagaaaggctatcaaagctgggacgtgatcagcatgcgt
gccgataacccgcaaaaggaggcgctgcgcagcaagtttctctctgaacatacccacggt
gaagatgaagtacgcttctttgtcgaaggggcggggctgttctgcctgcatcttgacggg
catatttttcagatcctgtgcgaaaaaaacgatctgatctcggttccggccgggacgccg
cactggtttgatatgggatcgtcaccgcatttcaccgccatccgcatcttcgacaatcag
gaaggctggatcgccaaatttaccggcgatccgattgcggacggctacccgcgcctgcct
taa

DBGET integrated database retrieval system