KEGG   Erwinia amylovora ATCC 49946: EAM_0902Help
Entry
EAM_0902          CDS       T01199                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00330  Arginine and proline metabolism
eay00332  Carbapenem biosynthesis
eay01100  Metabolic pathways
eay01130  Biosynthesis of antibiotics
eay01230  Biosynthesis of amino acids
Module
eay_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EAM_0902 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    EAM_0902 (proB)
Enzymes [BR:eay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EAM_0902 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CBJ45577
Position
1013336..1014439
Genome map
AA seq 367 aa AA seqDB search
MSSSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAMAAGREHL
GYPELPPTIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADLEDRERFLNARDT
LRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
HNPQAELIRDVRGIDDDLRALAGDSISGLGTGGMTTKLQAADIACRAGIDTIIAAGSRPG
VIGDAIACNPVGTRFHALETPLENRKRWIFGAPPAGELVVDDGALSAILERGSSLLPKGI
REISGNFSRGEVIRIRNLQGRDVAHGVSRYNSDAMRMIAGHHSQQIGDILGYEYGPVAIH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagccagaccctggtggtgaaactggggaccagcgttttgaccggcggttca
cgtcggctgaaccgggcgcacatcgttgagctggtgcgtcagtgcgcccagcagcacgcg
gcagggcaccggattgtcattgtcacttcgggcgcgatggcggccgggcgcgagcatctt
ggttacccggaactgccgccgaccatcgcttccaagcagctgttggccgcggtggggcaa
agccgactgatccagctgtgggaacaactgttctcaatctacggcattcatatcggccag
atgctgctgacgcgtgccgacctggaagacagagaacgcttcctcaatgcccgcgatact
ttacgtgcgctgcttgataaccacatcgtgccggtgatcaatgaaaatgatgcggttgcc
accgccgagatcaaagtgggcgataacgacaacctgtcggcgctggcagcgatcctcgcc
ggagccgataagctgctgctgctgaccgatcagcaggggctgttcaccgccgatccgcgt
cataatccgcaggcggagctgatccgcgacgtcagggggattgatgacgatctgcgcgcg
ctggccggtgacagcatttccggccttggcaccggaggtatgacgaccaaattgcaggcg
gcggatattgcctgccgtgccggcatcgataccattattgcggcgggtagccgtccgggt
gtgattggcgatgcaatcgcttgcaacccggttggtacacgcttccacgcgctggaaacc
ccgctggaaaaccgtaaacgttggatcttcggcgcacctccggccggggaactggtggtt
gatgacggcgcactgtcggcgatccttgagcgcggcagttcgctgctgccaaaaggaata
cgcgaaatcagcggtaacttctcccgtggagaagtgatccgcatccgcaacctgcagggg
cgcgatgtggctcatggcgtatcgcgctacaacagcgacgcgatgcgcatgattgccggg
catcattcccagcagatcggtgacattttaggttatgaatatggtccggtggctattcat
cgcgacgatatgatcgttagctaa

DBGET integrated database retrieval system