KEGG   Erwinia amylovora ATCC 49946: EAM_0926Help
Entry
EAM_0926          CDS       T01199                                 

Gene name
lacZ
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eay00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:eay00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1030256..1033336)
Genome map
AA seq 1026 aa AA seqDB search
MASRDPLTLQQLLSQRHWENPALTQLNRLPTHTPLASWRSEDAARSDLPSPSIRELDGEW
GFNYFHRPQAVPDEWLYHDLPQVGSIAVPSNWQLAGYDAPIYTNVQYPIPVAPPRVPEDN
PTGCYSLNFRCPPDWLQSGQTRIIFDGVNPAFYLWCNGEFIGYSQDSRLPAEFDLSHSLR
AEENRIAVMVLRWCDGSYLEDQDMWRMSGIFRSVSLLHKPVVRLNDIQTDTRLSPELRSA
RLQVMALCSLPDASAWRLEVKLWHEDTLIAQQQQPFGTPVVDERGSYLDRTRLSLHIDQP
LLWSAETPHLYRAVVTLLDADGRLVEAEACDVGFRQIEVSGGLLKLNGKALLIRGTNRHE
HHPHRGQVMDEPAMVTDILLMKQHNFNAVRCSHYPNHPLWYRLCDRYGLYVVDEANIETH
GMQPMNRLADDPVWFQAFSERVIRMVQRDRNHACIIIWSLGNESGHGSTHDALYRWVKSN
DPGRPVQYEGGGADSAASDIICPMYARVDQDQPFAAVPKWSIKKWIGLPEETRPLILCEY
AHAMGNSLGGFERYWRAFRQFPRLQGGFIWDWADQSLTRHDADGSSWQAYGGDFGDTPND
RQFCMNGLLFADRSPHPALFEAQRAQQFFQFALVSTAPIIVSITSEYLFRHSDNEQLCWR
IEHQGKGVAEGQITLDLPPEGTLCLTLGELPSLTGELWLRVSVIQPTATAWSAAGHRVAW
DGWRLPAALALPQPQMTGGLPRLHQQPQLIEIVHGQQRWHFCRQSGELIQWLQANEPQLL
SPLRDLFVRAPLDNDIGISQASCIDPNAWVERWQRAGYFQLESRLLSLQTDILSDGVQIR
SEQAWLTGTALRFLSRKCYRINLQGEVLVEIEVDIAAGQPPPARIGLHCQLRDVAQNASW
LGLGPHENYPDRRLAAEFSRWQLPLEALSTPYVFPSENGLRGGTRELIFGRWQIGGDFHF
SLSRHSVEQLRQTSHRHLLRDEPGCWLILDGYHMGVGGDDSWSQSVNEEFLLSARQYRYQ
LTLARH
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcgtgatccactcaccttgcagcagctattatcccagcgccactgggaaaac
ccggcactgacccagcttaaccggctgccgacccatacgccgcttgccagctggcgcagt
gaagatgctgcgcgcagcgatctgcccagcccgagtatccgagagctggacggagaatgg
ggctttaactatttccaccgtccgcaagcggtgccggatgaatggttgtatcacgatctg
ccccaggtcggcagcatagcagttccgtccaactggcagctggcgggttatgatgctccc
atttataccaacgtgcagtacccgataccggtggccccgccacgcgttcctgaggataat
ccgaccggttgttattcgctcaactttcgttgcccacccgactggctgcaaagcggccag
acgcgaatcatcttcgacggggttaacccggccttttacctgtggtgcaacggcgagttt
attggttactcccaggacagccggctgccggccgaattcgacctcagccacagcctgcgg
gcggaagaaaaccgcattgccgtgatggtactgcgctggtgcgatggcagctatctggaa
gaccaggatatgtggcgcatgagcggaattttccgcagtgtcagcctgctgcataaaccg
gtggtgaggctgaatgacattcagacagatacccggctaagccctgagttacgcagtgca
cggcttcaggtaatggcgttatgttcactgcctgatgccagcgcctggcggcttgaggtg
aagttgtggcacgaagatacgctgattgcacagcagcagcagccgtttggcacgccggtg
gttgacgagcgcggcagctacctcgaccgtacgcggctgtccctgcatatcgaccagccc
ctgctgtggagcgccgaaactccgcatctttaccgtgcggtggttaccctgctggatgct
gatggcagattagttgaagcagaagcctgtgacgttggctttcgacagattgaggtgagc
ggcgggttgctgaaactcaacggcaaagcgctgttgatccgtggcaccaaccgccatgag
caccacccgcatcgcggtcaggtgatggatgagcctgcgatggtcaccgatattctgctg
atgaaacagcataacttcaacgccgtgcgctgctctcattacccgaatcatccgttgtgg
taccgactgtgcgaccgttacgggctgtatgtggtcgatgaagccaatattgaaacgcac
ggaatgcaaccgatgaaccggctggcggacgatccagtctggtttcaagctttcagcgaa
cgggtcattcgcatggtgcaacgcgatcgcaaccatgcctgtattatcatctggtcgctg
ggcaacgaatctggccacggcagtacccacgatgcgctttatcgctgggtcaaaagtaac
gatccaggccggccggtgcagtacgaaggcggcggagccgactccgccgccagcgatatc
atctgcccgatgtatgcgcgggtcgatcaggaccaaccttttgcggccgtgcctaaatgg
tcaataaaaaaatggataggcctgccggaagagacccgcccgttgatcctctgtgaatac
gcccatgcaatgggcaacagccttggcggtttcgaacgttactggcgggcctttcgccag
ttcccccgcctgcagggagggtttatctgggactgggccgaccaaagcctgacgcgccat
gatgccgatggcagcagctggcaagcctatggcggtgactttggcgacacgcctaatgac
cgtcagttctgtatgaacgggctgctctttgccgaccgtagtccgcatccggcactattt
gaagcccaacgcgcccaacagtttttccagtttgctctggtcagtaccgcaccgataatc
gtcagcattaccagtgaatacctgtttcgtcacagcgacaacgaacagctatgctggcgt
attgagcatcaggggaaaggggttgctgaaggccaaattaccttggacctgccgccggaa
ggcactctttgcctgacgctgggtgaactgccctcgttaaccggcgaactttggctgcgg
gtctcggtgatccagcccacagccaccgcatggtcagcggccgggcatcgcgtggcgtgg
gatggctggcggctgccggcggcgctggctctgccacaacctcagatgaccggtgggctg
cctcgtttacatcagcagccgcagctgattgagatcgtccatggtcagcagcgctggcat
ttctgccggcaaagcggtgagctgatacagtggctgcaagcaaatgaaccacagttgctc
tccccgctgcgcgatctgttcgtgcgtgccccgctggataacgatatcggtatcagtcag
gcctcatgcattgacccaaacgcctgggtggagcgctggcaacgtgcgggctatttccag
cttgaaagccggctgctaagcctgcagacggatatcctgagcgacggagtgcaaatccgc
agcgaacaggcatggctgacaggtacagcgttacgtttcctcagtcgcaaatgctaccga
ataaatcttcagggtgaggtgcttgttgaaatcgaagtcgacattgccgccgggcagccg
ccaccagcgcgtattggcctgcactgccagctgcgcgacgtggcgcagaatgccagctgg
ctgggtcttggcccacatgaaaactacccggaccgacggctggcggcagagttctcacgc
tggcagctgccgcttgaagcattgagcacgccttatgttttcccaagtgaaaacggcctg
cggggcggcaccagagaactgatctttggtcgctggcagatcggcggtgatttccacttt
tcgcttagtcgccacagcgttgaacagctgcgtcagacttcgcatcgccatttgctgcgc
gatgaaccgggctgctggctgatccttgatgggtaccatatgggtgtgggcggtgatgac
tcctggagccaaagcgtcaatgaagaatttttgctttccgcccgccagtatcgctatcaa
ttaaccctggcgcgccactga

DBGET integrated database retrieval system