KEGG   Erwinia amylovora ATCC 49946: EAM_1026Help
Entry
EAM_1026          CDS       T01199                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eay00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EAM_1026 (recR)
DNA repair and recombination proteins [BR:eay03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EAM_1026 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1130921..1131526
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLETLMESLRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDICTICANPRRRQNGLICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEKESIQEVILATNPTVEGEATANYIASLCEQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLVGRQKFKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagccccctcctcgaaacattaatggagtcgctgcgctgcctgccgggcgtt
gggcctaagtcggctcaacgcatggcttttcagctgttacagcgcgatcgtagcggcggg
atgcgcctggctcaggctttgacgcgggcgatgtcggagatcggacactgtgccgactgt
cggaccttcactgaacaggacatttgcaccatttgcgctaatccacggcgtcggcaaaat
gggctgatttgcgtagtggaaagcccggcagacatccacgccattgagcaaaccgggcag
ttcgctggccgttactttgtactgatggggcatctgtcgccgctggatggtatcgggcca
gatgacatcggccttgaccggctggagcagcggctggaaaaggaatcgattcaggaagtg
atcctcgccaccaatccgacggtggaaggtgaggcaaccgctaactacattgccagcctg
tgtgaacagtacggcgtggacgccagccgcattgcgcatggtgttccggtgggcggagag
ctggaaatggtcgatggcaccacgctgtcgcattcactggtcgggcgtcaaaagttcaaa
ttttga

DBGET integrated database retrieval system