KEGG   Erwinia amylovora ATCC 49946: EAM_1064Help
Entry
EAM_1064          CDS       T01199                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EAM_1064 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAM_1064 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    EAM_1064 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EAM_1064 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EAM_1064 (adhP)
   00626 Naphthalene degradation
    EAM_1064 (adhP)
Enzymes [BR:eay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EAM_1064 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1167941..1168957)
Genome map
AA seq 338 aa AA seqDB search
MKAAVVTHDHQVDVVEKTLRALQHGEALLTMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVKSVGPGVTSLKPGDRASVAWFFKGCGHCEYCNSGNETLCREAVNAGYTADGGMAEE
CIVAADYAVKVPDGLDPAIASSITCAGVTTYKAVKISGISPGKWLVVYGLGGLGNLALQY
AKNVFNAKVIAVDISDDQLKFAEEMGADMVINSRNEDAAKLIQQRTGGAHAAVVTAVAKA
AFNSAVDAMRAGGRIVAVGLPPESMSLNIPRLVLDGIQVVGSLVGTREDLAEAFQFAAEG
KVVPKVTRRPLQDINAIFHEMESGKIVGRMVIDFNSTH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgtcactcacgatcatcaggttgatgtggtagagaaaaccctccgt
gcgctgcagcatggcgaagccctgctcaccatggagtgctgtggcgtgtgccacactgac
ctgcacgttaaaaacggagatttcggcgataaaaccggcgttatcctcgggcatgaaggg
attggcgtagtgaaatctgtcggcccgggcgtaacgtccctcaagcccggcgaccgtgcc
agcgtggcgtggtttttcaagggctgcggccactgtgaatactgcaacagcggcaatgaa
acgctgtgccgggaggcggtcaacgccggttataccgccgatggcggcatggctgaagag
tgtatcgtggcggcggattatgccgtgaaggtgcctgacggtctcgatcctgcaatcgcc
agcagcatcacctgtgccggtgtcactacctataaggccgtcaaaatctccggcatttcc
cccggtaagtggctggttgtctatggcctcggcggtctgggtaatctggcgctgcaatac
gcaaaaaacgtgttcaatgccaaagtcatcgccgttgatatcagcgatgaccaactgaag
tttgccgaagagatgggggccgatatggtcatcaactcacgtaatgaagacgcggcaaag
ctgatccaacagcgcaccggtggcgcacatgccgccgtggtcacggcggtggcgaaagcg
gcgtttaactctgcggtggatgcgatgcgcgccggtggccgtattgtggcggtgggcctg
ccgccggaatcgatgagcctgaatatcccgcgcctggtgctggacggcatccaggtcgtg
ggttcgctggtcggcacgcgtgaggatttagctgaagccttccagttcgccgctgagggc
aaggttgtaccaaaagtaacgcgccgcccgctacaggatatcaatgcgatcttccacgaa
atggagagcggtaaaatcgtgggccgcatggtgattgattttaacagcacccattaa

DBGET integrated database retrieval system