KEGG   Erwinia amylovora ATCC 49946: EAM_1169Help
Entry
EAM_1169          CDS       T01199                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00020  Citrate cycle (TCA cycle)
eay00190  Oxidative phosphorylation
eay00650  Butanoate metabolism
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01120  Microbial metabolism in diverse environments
eay01130  Biosynthesis of antibiotics
eay01200  Carbon metabolism
Module
eay_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eay_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eay_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAM_1169 (sdhD)
   00650 Butanoate metabolism
    EAM_1169 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EAM_1169 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CBJ45844
Position
1268297..1268647
Genome map
AA seq 116 aa AA seqDB search
MVSNASALGRNGIHDWLLLRAAAMIMTLYVLYILAFIVMSGTLTYDIWRGFFASSFTKVF
TLLTLFSILVHGWIGMWQVLTDYIKPLALRMMLQLVVVVALLVYAIYGTVVVWGAS
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgcactggggcgcaatggcattcatgactggctgctgctgcgt
gccgccgctatgataatgaccctttacgtgttgtacatcctcgcttttatcgtcatgtca
ggcaccctgacctatgatatctggcgtggtttttttgcctcatcctttactaaagtcttc
acccttctgacgttgttttctatcctggtgcacggctggatcgggatgtggcaggtactg
accgactatattaaaccactggcgttgcgcatgatgctgcagctggttgttgtggtagca
ctgttggtgtatgccatttatggaactgttgttgtgtggggtgcgtcatga

DBGET integrated database retrieval system