KEGG   Erwinia amylovora ATCC 49946: EAM_1173Help
Entry
EAM_1173          CDS       T01199                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2 oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAM_1173 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAM_1173 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    EAM_1173 (sucB)
Enzymes [BR:eay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EAM_1173 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274197..1275417
Genome map
AA seq 406 aa AA seqDB search
MSSVDIVVPDLPESVADATVATWHKKTGDSVKRDEVLVEIETDKVVLEVPASADGVLEAI
LEEEGATVISRQALGRLKEGNSGGKETSAKAEANESTPAQRQTASLEEESNDALSPAIRR
LIAEHSLDPAAIKGSGVGGRITREDVEKHLAQAAPATKAAPEAAEAAVPADLANRSEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEVNMQPIMALRKQYGEAFEKRHGVRLGFMSFYI
KAVVEALKRYPEVNASIDGTDVVYHNYFDVSIAVSTPRGLVTPVLKDVDALSMADIEKKI
KELAVKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVN
GQVVILPMMYLALSYDHRLIDGRESVGYLVAIKELLEDPARLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatatcgttgttcctgacctgcctgagtccgtggctgacgccaccgta
gccacctggcacaaaaaaaccggcgacagcgtcaagcgtgatgaagtgctggtggaaatc
gaaaccgataaagtagtgctggaagtaccggcctctgccgacggcgtgctggaagcgatc
cttgaagaagagggtgccacggtgatttcccgtcaggcgctgggtcgcctgaaagagggc
aacagcggtggcaaagagacctctgccaaagccgaagccaatgaatcgacgccagcacag
cgccagacggcatcgctggaagaagaaagcaacgatgcacttagcccggctattcgtcgc
ctgattgccgagcacagccttgacccggcagcgattaaaggcagcggtgtcggcgggcgc
atcacgcgtgaggacgtggaaaaacatctggcgcaggctgccccggcgaccaaagctgca
cctgaagcggcagaagcggctgtccccgccgatctggcgaaccgcagtgaaaaacgtgtg
cccatgactcgtctgcgcaagcgcgtggccgaacgtctgctggaagcgaagaacagcacc
gccatgctgaccaccttcaatgaagtgaacatgcagccgattatggcgctgcgaaagcag
tatggcgaagcgttcgaaaaacgtcacggcgtccgtctgggctttatgtccttctatatc
aaagcggtagtagaagccctgaagcgttacccggaagtgaatgcgtcaatcgacgggacg
gatgtggtttaccataactactttgacgtcagtattgccgtctctacgccacgcggcctg
gtaaccccggtgctgaaagatgtggatgcgctgagcatggccgatattgaaaagaaaatc
aaagagctggcggtgaaaggccgtgatggcaagctcaccgtcgacgaactgaccggcggt
aacttcactatcactaatggtggtgtctttggttcactgatgtccacgccgatcatcaac
ccgccacagagcgctattcttggtatgcatgcgatcaaagatcgcccgatggcggttaat
ggtcaggtggtgatcttgccaatgatgtatctggcgctctcttacgatcaccgtctgatt
gatggccgtgaatccgttggctatctggtggcgatcaaagagctgctggaagacccggct
cgtctgctgctggacgtctaa

DBGET integrated database retrieval system