KEGG   Erwinia amylovora ATCC 49946: EAM_1174Help
Entry
EAM_1174          CDS       T01199                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00020  Citrate cycle (TCA cycle)
eay00640  Propanoate metabolism
eay00660  C5-Branched dibasic acid metabolism
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01120  Microbial metabolism in diverse environments
eay01130  Biosynthesis of antibiotics
eay01200  Carbon metabolism
Module
eay_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eay_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAM_1174 (sucC)
   00640 Propanoate metabolism
    EAM_1174 (sucC)
   00660 C5-Branched dibasic acid metabolism
    EAM_1174 (sucC)
Enzymes [BR:eay01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EAM_1174 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CBJ45849
Position
1275511..1276677
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRTFAENWLGKRLVTYQTDAGGQPVNQILVEAATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPHLIHKMALDPLTGPQPYQGRELAFKLGLSGKQVGQFTKI
FMGLATLFLERDLALVEINPLVVTKQGDLVCLDGKLTADGNALFRQPDLREMRDPSQEDS
REAHAAQWELNYVALEGNIGCMVNGAGLAMGTMDIVKLSGGQPANFLDVGGGATKERVTE
AFKIILSDDAVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLSDAAQRVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgagtatcaggcaaaacagttgttcgcacggtatggcttaccggcacca
accggttatgcctgcacaacgccgcgtgaagcagaagaagccgcctccaagattggtgct
ggcccgtgggtagtgaaatgtcaggttcatgccggtggccgtggtaaagcgggcggcgtg
aaggttgtcaacagcaaagaagatatccgcacatttgccgaaaactggctgggtaaacgt
ctggtgacctatcagactgacgctggcggtcagccggtaaaccagatcctggttgaagcc
gccaccgatatcgataaagaactttatctcggcgcggtggttgaccgtggtacccgccgg
gtggtgtttatggcttccaccgaaggtggggttgaaatcgaaaaggtggcggaagaaacc
ccgcacctgatccacaaaatggcgctcgatccactgaccggtccccagccttatcagggc
cgcgagctggcgtttaagctcgggcttagcggtaagcaggtagggcagttcaccaagatc
tttatggggctggcaacgctgttccttgagcgcgatctggcgctggttgagatcaacccg
ctggttgtcaccaaacagggcgatctggtgtgcctcgatggcaagctgaccgccgacggc
aatgcgctgttccgccagcccgatctgcgcgaaatgcgtgacccaagccaggaagactcg
cgtgaagcgcatgccgcccagtgggaactgaactatgttgccctggaaggcaacattggc
tgcatggttaacggtgccggcctggcgatgggtaccatggacattgtgaaactgagcggt
ggtcagccggcaaacttcctcgacgtgggcggcggtgcgaccaaagagcgcgttaccgaa
gcctttaaaatcattctgtctgacgacgcggtgaaagcggtgttcgttaacatattcggc
ggcatcgtacgctgcgacctgatcgcagacggcattatcggtgcggtagcagaagtgggc
gtcaacgtaccggtagtcgttcgtctggaaggaaacaatgccgagctgggtgctaaaaaa
ctggcggacagcggcctgaatattattgcagcaaccagcctgagcgatgcggcgcagcgc
gttgttgccgcagcggagggtaaataa

DBGET integrated database retrieval system